BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0269 (745 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13990.1 68417.m02164 exostosin family protein contains Pfam ... 29 3.3 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 7.5 At4g32810.1 68417.m04667 dioxygenase-related low similarity to b... 27 9.9 >At4g13990.1 68417.m02164 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 521 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -1 Query: 304 IYTDNIQSNSKRN*RNRYYKSVLLFFIHTFIYLCFQITAI 185 I T ++N+ N N ++ V LFFI F+ LCF +A+ Sbjct: 15 ITTGKFRTNNNNNHNNVWFV-VPLFFILCFVLLCFDYSAL 53 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = -2 Query: 492 IYYVFYIISLKYFLY*ILHLVYYKRLSYLKTL 397 IY++F++I++K +L I ++Y LS + T+ Sbjct: 301 IYHIFFLINIKTYLIYITWIIYLFLLSTIGTI 332 >At4g32810.1 68417.m04667 dioxygenase-related low similarity to b,b-carotene-9',10'-dioxygenase [Mus musculus] GI:12666529; contains Pfam profile PF03055: Retinal pigment epithelial membrane protein Length = 570 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 666 DGNSIVIIIKCCKHLANTYTIFLL 737 DG + VII CC+H A+T + +L Sbjct: 384 DGKATVIIADCCEHNADTRILDML 407 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,986,223 Number of Sequences: 28952 Number of extensions: 231370 Number of successful extensions: 495 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -