BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0267 (539 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071145-1|AAL48767.1| 520|Drosophila melanogaster RE18068p pro... 29 4.1 AE014297-1231|AAF54580.2| 520|Drosophila melanogaster CG4674-PA... 29 4.1 >AY071145-1|AAL48767.1| 520|Drosophila melanogaster RE18068p protein. Length = 520 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 412 AGSSVSAVWTPRSRTSCRFSRVFQQEYSSTPL 317 +GS S +P +RTS R S V YSS+PL Sbjct: 396 SGSQSSQYGSPSARTSLRSSNVPYMPYSSSPL 427 >AE014297-1231|AAF54580.2| 520|Drosophila melanogaster CG4674-PA protein. Length = 520 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 412 AGSSVSAVWTPRSRTSCRFSRVFQQEYSSTPL 317 +GS S +P +RTS R S V YSS+PL Sbjct: 396 SGSQSSQYGSPSARTSLRSSNVPYMPYSSSPL 427 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,954,891 Number of Sequences: 53049 Number of extensions: 353579 Number of successful extensions: 853 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2053700352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -