Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0260
         (423 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC5D6.10c |mug116||sequence orphan|Schizosaccharomyces pombe|c...    25   6.4  

>SPAC5D6.10c |mug116||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 135

 Score = 24.6 bits (51), Expect = 6.4
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -3

Query: 235 FHSFHIFFIKQISLYRC--EDSSTAHFNLSLTVTRDSSYVR*RSLTIPCLLTFN*R*TFH 62
           FHSFH FF+   ++  C  +  S+A  +        S Y      +IP ++ F    TF 
Sbjct: 21  FHSFHCFFLLCFTVMLCVVQQCSSAMTSFRCPTFSLSKYTCVLPASIPEMILF----TFS 76

Query: 61  NKTYNS 44
           + T+ +
Sbjct: 77  SHTFQT 82


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,623,059
Number of Sequences: 5004
Number of extensions: 29064
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 150383836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)