BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0260 (423 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_51260| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_18832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 27.1 bits (57), Expect = 6.4 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 277 HHRPKWKVIIEYDLFHSFHIFFIKQISLYRCEDSSTAHFNLSLTVT 140 H KW + + FH+F + I+ + SSTA L LT T Sbjct: 3 HEPEKWPFHVSWTEEWPFHVFEYRNIASKNRKYSSTASKRLHLTFT 48 >SB_51260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 26.6 bits (56), Expect = 8.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 415 LYDKYSFNLKTFTVEILN*LHPATLTSLYSIILSDI 308 L D YS +L L+ ++P L+S+YS LSDI Sbjct: 18 LSDIYSTDLSDIYPTDLSDIYPTYLSSIYSTDLSDI 53 >SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 627 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 265 KWKVIIEYDLFHSFHIFFIKQISLYRCEDSSTAHFNLSLTV 143 +W+ II L+ + FI+ I L + SS ++FN ++ + Sbjct: 224 QWEEIISKHLWTAVSTHFIENIYLPAAQSSSASNFNTAVDI 264 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,345,200 Number of Sequences: 59808 Number of extensions: 187543 Number of successful extensions: 235 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -