BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0260 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 22 8.0 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 22 8.0 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.2 bits (45), Expect = 8.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -2 Query: 113 KFNNSLFTYI*LTLNFPQ*NL*QRPFYTRHIPTSLXP 3 K+N L L P R YT H PT L P Sbjct: 491 KYNELEANNFPLPLLLPGLEAVNRTLYTAHFPTHLLP 527 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 22.2 bits (45), Expect = 8.0 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = -1 Query: 249 LSMIYFILSIFFLLNKYRSIVARIVARPILICHS 148 + ++ FI++ FLL++++++ + P L C S Sbjct: 18 VGVVIFIVTPRFLLSRHKNLEGSAMYVPPLYCDS 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,559 Number of Sequences: 2352 Number of extensions: 6570 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -