BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= an--0260
(423 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z46793-1|CAA86770.1| 367|Caenorhabditis elegans Hypothetical pr... 27 7.3
>Z46793-1|CAA86770.1| 367|Caenorhabditis elegans Hypothetical
protein C56G7.2 protein.
Length = 367
Score = 26.6 bits (56), Expect = 7.3
Identities = 11/38 (28%), Positives = 21/38 (55%)
Frame = -3
Query: 244 YDLFHSFHIFFIKQISLYRCEDSSTAHFNLSLTVTRDS 131
YDL ++ + IS+++C +S + ++ L V DS
Sbjct: 110 YDLENAMLVVIRYMISIFKCSNSIITYLSIDLGVIEDS 147
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,649,277
Number of Sequences: 27780
Number of extensions: 151589
Number of successful extensions: 252
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 251
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 252
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 692685370
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -