BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0194 (379 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 126 6e-30 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 123 5e-29 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 123 5e-29 At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putati... 44 4e-05 At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putati... 44 4e-05 At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related... 36 0.009 At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putati... 33 0.048 At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putati... 33 0.048 At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, puta... 33 0.063 At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putati... 32 0.15 At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putati... 32 0.15 At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, puta... 31 0.25 At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, puta... 31 0.34 At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, puta... 30 0.44 At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, put... 29 1.0 At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, put... 29 1.0 At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, put... 29 1.0 At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, put... 29 1.0 At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putati... 29 1.0 At5g58630.1 68418.m07347 expressed protein 28 1.8 At1g77770.2 68414.m09056 expressed protein 28 2.4 At1g77770.1 68414.m09055 expressed protein 28 2.4 At5g35610.1 68418.m04249 paired amphipathic helix repeat-contain... 27 5.5 At5g17850.1 68418.m02092 cation exchanger, putative (CAX8) simil... 26 9.6 At1g65440.1 68414.m07424 glycine-rich protein 26 9.6 At1g50660.1 68414.m05696 expressed protein similar to liver stag... 26 9.6 At1g17400.1 68414.m02124 hypothetical protein 26 9.6 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 126 bits (303), Expect = 6e-30 Identities = 60/106 (56%), Positives = 77/106 (72%), Gaps = 4/106 (3%) Frame = +3 Query: 69 MTIGKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKI---KSKNSK 239 M++ K++KM Q INYR+RV +QD R I F AFD+HMNL+LGDCEEFRK+ K Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLIGKFMAFDRHMNLVLGDCEEFRKLPPAKGNKKT 60 Query: 240 TADREEKRTLGFVLLRGENIVSLTIEGPPPPQEGSA-SRSLTGSYG 374 +REE+RTLG VLLRGE ++S+T+EGPPPP+E A S S+T G Sbjct: 61 NEEREERRTLGLVLLRGEEVISMTVEGPPPPEESRAKSGSVTAVAG 106 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 123 bits (296), Expect = 5e-29 Identities = 54/95 (56%), Positives = 72/95 (75%), Gaps = 2/95 (2%) Frame = +3 Query: 69 MTIGKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSK--T 242 M++ K++KM Q INYR+RV +QD R + F AFD+HMNL+LGDCEEFRK+ K Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKIN 60 Query: 243 ADREEKRTLGFVLLRGENIVSLTIEGPPPPQEGSA 347 +RE++RTLG VLLRGE ++S+T+EGPPPP+E A Sbjct: 61 EEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRA 95 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 123 bits (296), Expect = 5e-29 Identities = 54/95 (56%), Positives = 72/95 (75%), Gaps = 2/95 (2%) Frame = +3 Query: 69 MTIGKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSK--T 242 M++ K++KM Q INYR+RV +QD R + F AFD+HMNL+LGDCEEFRK+ K Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKIN 60 Query: 243 ADREEKRTLGFVLLRGENIVSLTIEGPPPPQEGSA 347 +RE++RTLG VLLRGE ++S+T+EGPPPP+E A Sbjct: 61 EEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRA 95 >At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 98 Score = 43.6 bits (98), Expect = 4e-05 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +3 Query: 105 INYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTAD---REEKRTLGF 275 ++ R+ V L+ R AFD+H+N+ILGD EE + +T + R KRT+ F Sbjct: 20 LDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVEIDDETYEEIVRTTKRTIEF 79 Query: 276 VLLRGENIV 302 + +RG+ ++ Sbjct: 80 LFVRGDGVI 88 >At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 97 Score = 43.6 bits (98), Expect = 4e-05 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%) Frame = +3 Query: 105 INYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEF---RKIKSKNSKTADREEKRTLGF 275 I R+ V L+ R AFD+H+N+ILGD EE +I + + R KRT+ F Sbjct: 20 IEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIEIDDETYEEIVRTTKRTVPF 79 Query: 276 VLLRGENIV 302 + +RG+ ++ Sbjct: 80 LFVRGDGVI 88 >At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related / snRNP-related contains similarity to snRNP-associated polypeptide N [Rattus norvegicus] GP|206694|gb|AAA42059 Length = 112 Score = 35.9 bits (79), Expect = 0.009 Identities = 19/66 (28%), Positives = 37/66 (56%) Frame = +3 Query: 87 NKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREEKRT 266 +++++ + ++ V ++D R F+ F DK N+IL D E+R I+ + E+R Sbjct: 25 SRLRKLLFRQMLVGIKDGRFFLGNFHCIDKQGNIILQDTVEYRSIRRSSPSPT---EQRC 81 Query: 267 LGFVLL 284 LG +L+ Sbjct: 82 LGMILI 87 >At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm5 [Homo sapiens] SWISS-PROT:Q9Y4Y9 Length = 88 Score = 33.5 bits (73), Expect = 0.048 Identities = 22/78 (28%), Positives = 35/78 (44%) Frame = +3 Query: 105 INYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREEKRTLGFVLL 284 I ++ VI++ + + K FD ++N++L D E+ TA+ L +LL Sbjct: 18 IGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEI-------TAEGRRVTKLDQILL 70 Query: 285 RGENIVSLTIEGPPPPQE 338 G NI L G P E Sbjct: 71 NGNNIAILVPGGSPEDGE 88 >At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm8 [Homo sapiens] SWISS-PROT:O95777 Length = 98 Score = 33.5 bits (73), Expect = 0.048 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +3 Query: 117 VRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREEKRTLGFVLLRGEN 296 + VI D R + K FD+ N+IL + E + T + ++ LG ++RG+N Sbjct: 15 ISVITNDGRNIVGVLKGFDQATNIILDESHE------RVFSTKEGVQQHVLGLYIIRGDN 68 Query: 297 I 299 I Sbjct: 69 I 69 >At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to SWISS-PROT:Q15357 small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] Length = 79 Score = 33.1 bits (72), Expect = 0.063 Identities = 20/84 (23%), Positives = 46/84 (54%) Frame = +3 Query: 78 GKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREE 257 G+ ++++++ ++++ L +R + T + FD+ MNL++ N+ + ++ Sbjct: 5 GQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVV-----------DNTVEVNGDD 53 Query: 258 KRTLGFVLLRGENIVSLTIEGPPP 329 K +G V++RG +IV T+E P Sbjct: 54 KTDIGMVVIRGNSIV--TVEALEP 75 >At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +3 Query: 84 NNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLIL-GDCEEFRKIKSKNSKTADREEK 260 + + +++ ++ V+L+D R + T ++FD+ N +L G CE R I ++ Sbjct: 12 STSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE--RVI------VGEQYCD 63 Query: 261 RTLGFVLLRGENIV 302 LG ++RGEN+V Sbjct: 64 IPLGLYVIRGENVV 77 >At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +3 Query: 84 NNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLIL-GDCEEFRKIKSKNSKTADREEK 260 + + +++ ++ V+L+D R + T ++FD+ N +L G CE R I ++ Sbjct: 12 STSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE--RVI------VGEQYCD 63 Query: 261 RTLGFVLLRGENIV 302 LG ++RGEN+V Sbjct: 64 IPLGLYVIRGENVV 77 >At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 31.1 bits (67), Expect = 0.25 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +3 Query: 168 FDKHMNLILGDCEEFRKIKSKNSKTADREEKRTLGFVLLRGENIVSLTIEG 320 FD++MNL+L + EE IK K ++ LG +LL+G+NI + G Sbjct: 46 FDEYMNLVLDEAEEV-SIKKKT--------RKPLGRILLKGDNITLMMNAG 87 >At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] SWISS-PROT:Q15357 Length = 80 Score = 30.7 bits (66), Expect = 0.34 Identities = 20/84 (23%), Positives = 44/84 (52%) Frame = +3 Query: 78 GKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREE 257 G+ ++++++ ++++ L +R T + FD+ MNL++ N+ + + Sbjct: 5 GQPPDLKKYMDKKLQIKLNANRMVTGTLRGFDQFMNLVV-----------DNTVEVNGND 53 Query: 258 KRTLGFVLLRGENIVSLTIEGPPP 329 K +G V++RG +IV T+E P Sbjct: 54 KTDIGMVVIRGNSIV--TVEALEP 75 >At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 30.3 bits (65), Expect = 0.44 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +3 Query: 168 FDKHMNLILGDCEEFRKIKSKNSKTADREEKRTLGFVLLRGENIVSLTIEG 320 FD++MNL+L + EE IK KN+ ++ LG +LL+G+NI + G Sbjct: 46 FDEYMNLVLDEAEEV-SIK-KNT-------RKPLGRILLKGDNITLMMNTG 87 >At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +3 Query: 108 NYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEF----RKIKSKNSKTADREEKRTLGF 275 N +V + +++R + +AFD+H N++L + E K K R + Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNRDRFISK 92 Query: 276 VLLRGENIV 302 + LRG++++ Sbjct: 93 MFLRGDSVI 101 >At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +3 Query: 108 NYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEF----RKIKSKNSKTADREEKRTLGF 275 N +V + +++R + +AFD+H N++L + E K K R + Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNRDRFISK 92 Query: 276 VLLRGENIV 302 + LRG++++ Sbjct: 93 MFLRGDSVI 101 >At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +3 Query: 108 NYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEF----RKIKSKNSKTADREEKRTLGF 275 N +V + +++R + +AFD+H N++L + E K K R + Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNRDRFISK 92 Query: 276 VLLRGENIV 302 + LRG++++ Sbjct: 93 MFLRGDSVI 101 >At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 109 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +3 Query: 108 NYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEF----RKIKSKNSKTADREEKRTLGF 275 N +V + +++R + +AFD+H N++L + E K K R + Sbjct: 34 NTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPVNRDRFISK 93 Query: 276 VLLRGENIV 302 + LRG++++ Sbjct: 94 MFLRGDSVI 102 >At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116 Length = 128 Score = 29.1 bits (62), Expect = 1.0 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +3 Query: 84 NNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADREEKR 263 + + +++ ++ V+L+D R + ++FD+ N +L + E R I D Sbjct: 12 STSLAAYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYE-RVI------VGDLYCDI 64 Query: 264 TLGFVLLRGENIV 302 LG ++RGEN+V Sbjct: 65 PLGLYIIRGENVV 77 >At5g58630.1 68418.m07347 expressed protein Length = 372 Score = 28.3 bits (60), Expect = 1.8 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 78 GKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHMNLILGDCEEFRKIKSKNSKTADR 251 GK+ +++ + Y V L+D FI++F+ L +C++ R + SKT D+ Sbjct: 107 GKHRRVKSTLEY---VELEDDDFFILSFEKDKNDKELGTRNCKKRRDTRENQSKTEDQ 161 >At1g77770.2 68414.m09056 expressed protein Length = 264 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 72 TIGKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHM 182 T+ K+ +M H N + R +QD+ +F+ F+ KHM Sbjct: 98 TVVKDARM--HFNSKRRTCMQDNCSFLGNFRKLKKHM 132 >At1g77770.1 68414.m09055 expressed protein Length = 265 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 72 TIGKNNKMQQHINYRVRVILQDSRTFIVTFKAFDKHM 182 T+ K+ +M H N + R +QD+ +F+ F+ KHM Sbjct: 98 TVVKDARM--HFNSKRRTCMQDNCSFLGNFRKLKKHM 132 >At5g35610.1 68418.m04249 paired amphipathic helix repeat-containing protein weak similarity to SP|P22579 Paired amphipathic helix protein {Saccharomyces cerevisiae}; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 155 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 199 IAKNSEKLNLKIVKLQTEKKKELWVLFFYV 288 I K++ + LKIVK + + K+E++V F V Sbjct: 6 ITKSNPRKYLKIVKNKLQNKREIYVRFLQV 35 >At5g17850.1 68418.m02092 cation exchanger, putative (CAX8) similar to sodium/calcium exchanger protein [Mus musculus] gi|13925661|gb|AAK49407; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 559 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 116 SKGYITRLSYIYCNF*SF 169 S+G+ LS++YCNF F Sbjct: 70 SQGFFDYLSFLYCNFEGF 87 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 132 QDSRTFIVTFKAFDKHMNLILGDCEE 209 ++ + VTFK + +MN ++ DC E Sbjct: 609 EEEKLLQVTFKLPENYMNRLISDCNE 634 >At1g50660.1 68414.m05696 expressed protein similar to liver stage antigen-1 (GI:510184) [Plasmodium falciparum]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum]; similar to liver stage antigen (GI:9916) [Plasmodium falciparum]; similar to Kinesin-like protein KLPA (Swiss-Prot:P28739) [Emericella nidulans] Length = 725 Score = 25.8 bits (54), Expect = 9.6 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 45 YLPNHSDKMTIGKNNKMQQH 104 YL +HSDK + G++NK++Q+ Sbjct: 157 YLYHHSDKPSGGQSNKIRQN 176 >At1g17400.1 68414.m02124 hypothetical protein Length = 310 Score = 25.8 bits (54), Expect = 9.6 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 171 DKHMNLILGDCEEFRKIKSKNSKTADREEKRTLGFV 278 ++ +N+ILG C+E I+SKN+K K ++ ++ Sbjct: 165 ERTINVILGRCKEI-SIESKNNKKKRDISKNSVSYL 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,193,927 Number of Sequences: 28952 Number of extensions: 122013 Number of successful extensions: 462 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -