BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0190 (780 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.8 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.8 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 174 GGHAEEHHHVL-RHVAARGGV 233 G H HHV+ HVAA G + Sbjct: 327 GHHIHAQHHVVNHHVAANGSL 347 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 682 TLITTHVITPKC 647 T IT H+ TPKC Sbjct: 475 TWITLHIWTPKC 486 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 682 TLITTHVITPKC 647 T IT H+ TPKC Sbjct: 475 TWITLHIWTPKC 486 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 682 TLITTHVITPKC 647 T IT H+ TPKC Sbjct: 475 TWITLHIWTPKC 486 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 682 TLITTHVITPKC 647 T IT H+ TPKC Sbjct: 475 TWITLHIWTPKC 486 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 14 RRKRTCPKSCSW 49 RRK+ CPK W Sbjct: 3 RRKQDCPKRMKW 14 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 270 DVPRDLVVGLRRGLHRVPRHVVERDDVLQH 181 + RD V G + +PRH D L H Sbjct: 15 EAARDFVQGYPASVQPLPRHFNPPSDKLHH 44 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 8.4 Identities = 5/14 (35%), Positives = 12/14 (85%) Frame = -2 Query: 707 FNKWNRYLYFNHYT 666 FNKWN++ +++++ Sbjct: 61 FNKWNQFRSYSNFS 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,475 Number of Sequences: 336 Number of extensions: 3583 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -