BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0184 (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0356 - 2707820-2708395,2708475-2708705,2709071-2709190,270... 29 3.9 07_03_1214 + 24931142-24932314,24934177-24934434 28 9.0 >12_01_0356 - 2707820-2708395,2708475-2708705,2709071-2709190, 2709281-2709401,2711588-2712027 Length = 495 Score = 29.1 bits (62), Expect = 3.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 251 NPHSMKSSTVPWILSLYLSCKVNDILPRSASVMSGTSFSSTNIKG 117 +P S SS+ YL+ D+LPR +S SG+S ST G Sbjct: 15 SPASRSSSSSSSSSLRYLATSDGDVLPRRSSSGSGSSLGSTGSLG 59 >07_03_1214 + 24931142-24932314,24934177-24934434 Length = 476 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 67 DYKKKLDYGLIVTILYCPFMFVDENDVPDITEAD 168 DY+ K+ +G+I T+ Y M DEN+ P+ + D Sbjct: 138 DYRSKV-FGMIRTLKYLDKMDADENERPESDDDD 170 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,482,935 Number of Sequences: 37544 Number of extensions: 337485 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -