BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0184 (740 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13550.1 68414.m01588 expressed protein ; expression support... 31 1.1 At1g13530.1 68414.m01586 expressed protein ; expression support... 29 3.2 >At1g13550.1 68414.m01588 expressed protein ; expression supported by MPSS Length = 394 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 82 LDYGLIVTILYCPFMFVDENDVPDITEADLGNISFTLHDKYKD 210 LD ++V Y PF+FV E D+ D + + + TLH ++++ Sbjct: 218 LDISVVVGKWYVPFIFVKEGDIIDQVKISM-YYNMTLHQRWEE 259 >At1g13530.1 68414.m01586 expressed protein ; expression supported by MPSS Length = 385 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 85 DYGLIVTI--LYCPFMFVDENDVPDITEADLGNISFTLHDKYKD 210 D+G V + Y PF+FV E D D + + S TLH ++++ Sbjct: 207 DFGKSVVVGKWYVPFLFVKEGDAKDQMKKSM-YYSMTLHQRFEE 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,172 Number of Sequences: 28952 Number of extensions: 317167 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -