BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0182 (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0534 + 18285477-18285689,18286189-18286348,18287924-182881... 30 2.2 03_05_0280 - 22671786-22672208 30 2.2 05_01_0397 - 3129679-3130144,3130655-3131104,3132215-3132273,313... 29 2.9 04_04_1255 + 32119565-32119685,32120052-32120218,32120332-321205... 29 2.9 08_02_0544 + 18445810-18445995,18446894-18447053,18448186-184483... 29 3.9 06_03_0052 - 16027570-16027617,16027789-16027795,16028103-160283... 29 3.9 >08_02_0534 + 18285477-18285689,18286189-18286348,18287924-18288124, 18288216-18288280,18288465-18288492,18288568-18288629, 18288885-18288971,18289310-18289360,18289663-18289884, 18291148-18291241,18291349-18291489,18291587-18291672 Length = 469 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 340 NYSEKLSDYFWVATVLKVKGYMGLLRYEGFG 432 NY S ++WV +L++ +G+ YEG G Sbjct: 273 NYMPTCSTWYWVLNLLQIPVSVGVTMYEGLG 303 >03_05_0280 - 22671786-22672208 Length = 140 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 217 ELFGC-DFLAAPVSLFKHAPLHEMWD 291 EL GC F A P+ F H P+ + WD Sbjct: 6 ELIGCVTFTARPIQEFLHIPMKDKWD 31 >05_01_0397 - 3129679-3130144,3130655-3131104,3132215-3132273, 3133136-3133305,3134655-3134771,3134980-3135166 Length = 482 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -1 Query: 211 SIHNCSQLKLPIV*WDLPVNHSKWHAIAGVGVKAPVESSLPCDLY 77 S+ + S +P D P H WH +AG P++S P D + Sbjct: 229 SLASSSSSHVPERTMDGPAYHDPWHPLAGPSDGRPLQSVQPADFH 273 >04_04_1255 + 32119565-32119685,32120052-32120218,32120332-32120532, 32120700-32120747,32121079-32121238,32121540-32121777, 32121874-32122021 Length = 360 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = +1 Query: 145 LSDLQA-GPIKQSAASVANSYEWKDELFGCDF---LAAPVSLFKHAPLHEMWDNTFEG 306 L DLQA GP+K A + + D + GCD+ +AAP++ P ++ + G Sbjct: 49 LKDLQALGPLKVFRADMDEEGSFDDAIAGCDYAFLVAAPMNFNSENPEKDLVEAAVNG 106 >08_02_0544 + 18445810-18445995,18446894-18447053,18448186-18448386, 18448474-18448538,18448697-18448761,18448784-18448874, 18448965-18449051,18449204-18449254,18449604-18449825, 18449987-18450080,18450159-18450299,18450391-18450476 Length = 482 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 340 NYSEKLSDYFWVATVLKVKGYMGLLRYEGFG 432 NY S ++WV L++ +G+ YEG G Sbjct: 286 NYMPTCSTWYWVLNFLQIPVSVGVTMYEGLG 316 >06_03_0052 - 16027570-16027617,16027789-16027795,16028103-16028341, 16028432-16028566,16028670-16028888 Length = 215 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 587 PVSCLTRNFFQSVYLSSIVRGGMSGLP 507 P + ++ NFF YL ++V+ G SGLP Sbjct: 158 PYTFVSCNFFAGYYLPTLVQPGASGLP 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,357,420 Number of Sequences: 37544 Number of extensions: 440899 Number of successful extensions: 1058 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -