BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0182 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 1.8 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 2.4 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 25 2.4 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 25 3.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.8 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.4 bits (53), Expect = 1.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 463 DSPKNLWSHHSQILHISEVP 404 ++P N+ + HSQ LHI E P Sbjct: 907 EAPTNVIAVHSQTLHIPECP 926 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 88 MAGMIPLEPLPQLQQWHATLSDLQAGPIKQSAASVANSY 204 MAG P E P L QW A + + P A + N + Sbjct: 182 MAGYDPCEGRPNLTQWMARVRE-STNPYYDQAHKLVNKF 219 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 545 LSSIVRGGMSGLPRVAHQPTG*TSEQHRFTQKSLESSLPNP 423 LSS V G SGLP + P T+ Q + + + NP Sbjct: 81 LSSSVGGAQSGLPDITRHPWLVTASQSALQKFASTDWMSNP 121 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 24.6 bits (51), Expect = 3.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 23 TLVFRDENTLIGDSN*WRVQIT 88 T+VF + ++ D N W VQ+T Sbjct: 151 TVVFANRRAVVEDVNEWAVQVT 172 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -3 Query: 599 SVRAPVSCLTRNFFQSVYLSSIVRGGMSGLPRVAHQPTG*T 477 ++R+ V+C N + ++ ++ G G+ A +P G T Sbjct: 17 TIRSEVTCPNHNISGTAIGTTNIQSGGDGVAAAASEPIGAT 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,209 Number of Sequences: 2352 Number of extensions: 18384 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -