BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0182 (739 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71266-10|CAA95838.3| 491|Caenorhabditis elegans Hypothetical p... 42 6e-04 Z36238-5|CAA85277.1| 381|Caenorhabditis elegans Hypothetical pr... 28 6.0 AF067610-1|AAC17538.2| 696|Caenorhabditis elegans Hypothetical ... 28 7.9 AC024202-7|AAK93868.3| 227|Caenorhabditis elegans Hypothetical ... 28 7.9 >Z71266-10|CAA95838.3| 491|Caenorhabditis elegans Hypothetical protein R06C7.7 protein. Length = 491 Score = 41.5 bits (93), Expect = 6e-04 Identities = 28/111 (25%), Positives = 50/111 (45%) Frame = +1 Query: 199 SYEWKDELFGCDFLAAPVSLFKHAPLHEMWDNTFEGMKVEVKNTDCDNYSEKLSDYFWVA 378 ++ W + L P+ LFK P E D G+++E + C+N + A Sbjct: 386 TFRWDEYLEKESAETLPLDLFKPMPSQERLDKFKVGLRLEAADM-CEN------QFICPA 438 Query: 379 TVLKVKGYMGLLRYEGFGSDDSKDFWVNLCCSEVHPVGWCATRGKPLIPPR 531 TV V G + + ++G+ D+ D ++ ++ P+GWC L PP+ Sbjct: 439 TVKSVHGRLINVNFDGW--DEEFDELYDVDSHDILPIGWCEAHSYVLQPPK 487 >Z36238-5|CAA85277.1| 381|Caenorhabditis elegans Hypothetical protein R74.6 protein. Length = 381 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 375 YPKVITKFFRIIITVCILHFNLHALKCVI 289 + K + KF+ + T + H NL +KCVI Sbjct: 178 HEKGLEKFYEAVSTAFMRHVNLQVVKCVI 206 >AF067610-1|AAC17538.2| 696|Caenorhabditis elegans Hypothetical protein F41A4.1 protein. Length = 696 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +1 Query: 169 IKQSAASVANSYEWKDELFGCDFLAAPVSLFKHAPLHEMWDNTFEGMKVEVKNTDCDNYS 348 I+ + V SY + + C+ + A + +PL M N F G DC N+S Sbjct: 235 IRSRISDVCRSYTYDNSTNECNLMWASARMLGRSPLESMKPNLFHG-----DLDDCVNFS 289 Query: 349 EK 354 K Sbjct: 290 LK 291 >AC024202-7|AAK93868.3| 227|Caenorhabditis elegans Hypothetical protein Y71H2B.11 protein. Length = 227 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 262 KHAPLHEMWDNTFEGMKVEVKNTDCDNYSEKL 357 K+A WD F+ K EVK TD YS KL Sbjct: 182 KNAATSSTWDKHFDNSKYEVKTTD---YSWKL 210 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,015,485 Number of Sequences: 27780 Number of extensions: 407680 Number of successful extensions: 929 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -