BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0182 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 28 0.11 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 0.98 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 25 0.98 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 0.98 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.1 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 27.9 bits (59), Expect = 0.11 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +1 Query: 199 SYEWKDELFGCDFLAAPVSLFKHAPLHEMWDNTFEGMKVEVKNTDCDNYSEKLSDYF 369 +++WKD LFG A +K H M + EV D+ EK +DY+ Sbjct: 232 NFQWKDGLFGLSLSALQTDGYKILYFHAMSSIAEFSVSTEVLQ---DHTLEKSNDYY 285 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 289 DNTFEGMKVEVKNTDCDNYSEKLSDYFWVATVL 387 D+ F + ++V +CDN +SD A V+ Sbjct: 169 DSFFVDLVIDVDPNNCDNTYAYISDLSGYALVV 201 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 24.6 bits (51), Expect = 0.98 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 372 PKVITKFFRIIITVCILHFNL 310 P I K+ RI+ VC + FNL Sbjct: 401 PSDIDKYSRIVFPVCFVCFNL 421 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 24.6 bits (51), Expect = 0.98 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 372 PKVITKFFRIIITVCILHFNL 310 P I K+ RI+ VC + FNL Sbjct: 401 PSDIDKYSRIVFPVCFVCFNL 421 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 24.6 bits (51), Expect = 0.98 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 372 PKVITKFFRIIITVCILHFNL 310 P I K+ RI+ VC + FNL Sbjct: 339 PSDIDKYSRIVFPVCFVCFNL 359 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 538 EDKYTDWKKFLVKQLTGARTL 600 +D Y WK + +K LT A L Sbjct: 6 DDSYDFWKNWDLKNLTEAEYL 26 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,139 Number of Sequences: 438 Number of extensions: 4875 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -