BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0177 (763 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.50 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 22 4.6 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 4.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.6 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 4.6 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.4 bits (53), Expect = 0.50 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +2 Query: 578 PRAINFPEPQSQVFAFPLTGPVRLPLRPQPETPSGPEPRMPFGPGPDGRMPPFAQAP 748 P+AI P + A + G PL T P+P +P P P P Q P Sbjct: 48 PQAILQVRPSTSAAA-DVDGWQVTPLPSDGTTSPEPDPEIPVAPEPAPLASPLVQEP 103 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 603 HSPRYLPSR*PVQYASLCVLSQRHLPV 683 H RYL R ++ A VLS+R + + Sbjct: 253 HYNRYLTRRRRIEIAHTLVLSERQIKI 279 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 603 HSPRYLPSR*PVQYASLCVLSQRHLPV 683 H RYL R ++ A VLS+R + + Sbjct: 253 HYNRYLTRRRRIEIAHTLVLSERQIKI 279 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 667 WLRTQREAYWTGQREGKYLGLWLREIDCPGLISSV 563 W RE W G G Y+G L D P L +V Sbjct: 1016 WKPPAREE-WNGDILGYYVGYRLANSDKPYLFETV 1049 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 603 HSPRYLPSR*PVQYASLCVLSQRHLPV 683 H RYL R ++ A VLS+R + + Sbjct: 253 HYNRYLTRRRRIEIAHTLVLSERQIKI 279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,538 Number of Sequences: 336 Number of extensions: 3740 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -