BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0171 (682 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.3 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 7.1 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -2 Query: 327 TPLHETTRPVQMKCFLSGLKQLNESVG 247 +P+ + RP Q+ C+++ Q G Sbjct: 513 SPISKKVRPPQVLCYITSWSQKRPGAG 539 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 114 RHETRSPMTPLDQLVSVATVQR 49 RHE +PM ++ SV T+ R Sbjct: 88 RHEMATPMATMNSYGSVGTLGR 109 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 617 FIYLLNKLQITHKFNFKDDIYLLLQF---TVYSLFKTWL 510 F YL+ + FNF +LL+ F T++ +WL Sbjct: 284 FRYLMKGIDRADSFNFNPHKWLLVNFDCSTMWLKDPSWL 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,027 Number of Sequences: 336 Number of extensions: 3986 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -