BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0166 (567 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) 31 0.87 SB_18286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) Length = 727 Score = 30.7 bits (66), Expect = 0.87 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 162 AKRQIENFDDEYPTASNQDAQEEPSFWDRVVK 257 A++Q E+ +DEY T S++ EEPS +++ Sbjct: 466 ARQQQEDAEDEYETVSHEPVSEEPSAPQEIIR 497 >SB_18286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 231 PSFWDRVVKVALKLFSKFVEWLNS*KRI 314 P WD +K ++ L FV WLNS R+ Sbjct: 1060 PYLWD--IKESISLLDTFVTWLNSKSRL 1085 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,005,540 Number of Sequences: 59808 Number of extensions: 270155 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -