BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0164 (808 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_49327| Best HMM Match : PKD_channel (HMM E-Value=0) 28 7.7 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 488 PNTKIAKTKVIPVPRSQIPRLYQYQYQEYVSDLYDLLETASKLQK 622 P K+AKTK +P PR Q+P+ + + DL T S+ K Sbjct: 206 PPPKLAKTKPVPPPRLQVPKSILNDCESVIPSKPDLTGTLSRQNK 250 >SB_49327| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1196 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -2 Query: 651 LINVFIIRFHFWSFEAVSNRS*RSLTYSWYWYWYNLGICDLGTGITLV 508 L+ +F++ F + F+ + + L W W L +C LG +T++ Sbjct: 724 LLLIFVLIFMYQEFKKIFKQRKAYLREVWNWMELALIVCVLGCAVTIL 771 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,919,180 Number of Sequences: 59808 Number of extensions: 409410 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -