BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0163 (354 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01590.1 68418.m00074 expressed protein 29 0.67 At1g17145.1 68414.m02090 expressed protein 29 0.67 At5g08370.1 68418.m00986 alpha-galactosidase, putative / melibia... 29 1.2 At1g78420.1 68414.m09138 expressed protein 29 1.2 At1g69260.1 68414.m07939 expressed protein 28 2.1 At2g26480.1 68415.m03177 UDP-glucoronosyl/UDP-glucosyl transfera... 27 2.7 At5g37400.1 68418.m04499 hypothetical protein contains Pfam PF04... 27 4.7 At3g23980.1 68416.m03012 dentin sialophosphoprotein-related cont... 27 4.7 At1g28570.2 68414.m03518 GDSL-motif lipase, putative similar to ... 27 4.7 At1g28570.1 68414.m03517 GDSL-motif lipase, putative similar to ... 27 4.7 At5g66160.2 68418.m08334 protease-associated zinc finger (C3HC4-... 26 6.3 At5g66160.1 68418.m08335 protease-associated zinc finger (C3HC4-... 26 6.3 At5g55630.2 68418.m06937 outward rectifying potassium channel (K... 26 6.3 At5g55630.1 68418.m06936 outward rectifying potassium channel (K... 26 6.3 At5g45300.1 68418.m05561 glycosyl hydrolase family 14 protein si... 26 6.3 At4g34930.1 68417.m04952 1-phosphatidylinositol phosphodiesteras... 26 6.3 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 26 8.3 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 26 8.3 At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 26 8.3 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 26 8.3 At3g19910.1 68416.m02521 zinc finger (C3HC4-type RING finger) fa... 26 8.3 >At5g01590.1 68418.m00074 expressed protein Length = 424 Score = 29.5 bits (63), Expect = 0.67 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +3 Query: 99 WNATKSSSIANLMIGKCSLDDAMKEFRLNGLDSPYNPDEDNIWSA 233 W + ++S + M + D M + L D+PY ++ + W A Sbjct: 118 WESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYRKEDKDYWRA 162 >At1g17145.1 68414.m02090 expressed protein Length = 335 Score = 29.5 bits (63), Expect = 0.67 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = -1 Query: 297 GLATTPA----WSTCSIGSMYLQLLARSRCCPRRDCTENPSRSV*TPSSRHP 154 GL TP+ C I +Y L RSRCC + CTE R + +P+S P Sbjct: 49 GLEETPSSHHDLEECPICFLYYPSLNRSRCCMKSICTECFLR-MKSPNSAQP 99 >At5g08370.1 68418.m00986 alpha-galactosidase, putative / melibiase, putative / alpha-D-galactoside galactohydrolase, putative similar to alpha-galactosidase SP:Q42656 from [Coffea arabica] Length = 396 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 213 EDNIWSARAVADTSTQWNTYSRQVSWPAPE 302 +DN S +AD + +W +Y+R SW P+ Sbjct: 218 QDNWKSMTLIADQNDRWASYARPGSWNDPD 247 >At1g78420.1 68414.m09138 expressed protein Length = 401 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 267 CSIGSMYLQLLARSRCCPRRDCTE 196 C I +Y L RSRCC + CTE Sbjct: 59 CPICFLYYPSLNRSRCCMKSICTE 82 >At1g69260.1 68414.m07939 expressed protein Length = 345 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 265 TRTPGRCRGQPPSGLPRYRSRA 330 T T R RG+P SGLPR+ + A Sbjct: 163 TATASRRRGRPSSGLPRWSATA 184 >At2g26480.1 68415.m03177 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 27.5 bits (58), Expect = 2.7 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = -3 Query: 217 SSSGLYGESKPFSLNSFIASSREH-----LPIIRLAMLDDLVAFQSEDRFERSGISWLNE 53 SSSG+ S NSFI +++E P+ L M + ++ S ER+ + WL + Sbjct: 197 SSSGIIHNSSDCLENSFITTAQEKWGVPVYPVGPLHMTNSAMSCPSLFEEERNCLEWLEK 256 Query: 52 DESTEL 35 E++ + Sbjct: 257 QETSSV 262 >At5g37400.1 68418.m04499 hypothetical protein contains Pfam PF04510 : Family of unknown function (DUF577)); common family comprised of At5g37410, At5g37400, At5g37920, At5g37460, At5g37650, At5g37470, At5g37420, At5g37430 Length = 623 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 4/25 (16%) Frame = +3 Query: 135 MIGKCSLD----DAMKEFRLNGLDS 197 ++ KCSLD D +EF LNGLDS Sbjct: 235 IVWKCSLDVVWNDMEEEFLLNGLDS 259 >At3g23980.1 68416.m03012 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 736 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 72 PLRSNLSSDWNATKSSSIANLMIGKCSLDDAMKE 173 PL+ + S N T + + NL ++DD KE Sbjct: 63 PLKQSAESTSNETHTKDVYNLSFSNTAMDDGSKE 96 >At1g28570.2 68414.m03518 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 317 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -1 Query: 297 GLATTPAWSTCSIGSMYLQLLARSRCCPRRDCTENPSRSV*TPSSRHPESIYR 139 G + P + C++G + L R R +C ++PS+ V E+ YR Sbjct: 230 GFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYR 282 >At1g28570.1 68414.m03517 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 384 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -1 Query: 297 GLATTPAWSTCSIGSMYLQLLARSRCCPRRDCTENPSRSV*TPSSRHPESIYR 139 G + P + C++G + L R R +C ++PS+ V E+ YR Sbjct: 297 GFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYR 349 >At5g66160.2 68418.m08334 protease-associated zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF02225: protease-associated (PA) domain and Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger); similar to ReMembR-H2 protein JR702 [Arabidopsis thaliana] gi|6942149|gb|AAF32326; identical to cDNA ReMembR-H2 protein JR700 mRNA, complete cds GI:6942146 Length = 290 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +3 Query: 72 PLRSNLSSDWNATKSSSIANLMIGKCSLDDAMKEFRLNGLDS 197 PL +S+W +++ A ++ G+CS +D + + +G + Sbjct: 67 PLLHAAASNWTQHRTTKFALIIRGECSFEDKLLNAQNSGFQA 108 >At5g66160.1 68418.m08335 protease-associated zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF02225: protease-associated (PA) domain and Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger); similar to ReMembR-H2 protein JR702 [Arabidopsis thaliana] gi|6942149|gb|AAF32326; identical to cDNA ReMembR-H2 protein JR700 mRNA, complete cds GI:6942146 Length = 310 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +3 Query: 72 PLRSNLSSDWNATKSSSIANLMIGKCSLDDAMKEFRLNGLDS 197 PL +S+W +++ A ++ G+CS +D + + +G + Sbjct: 67 PLLHAAASNWTQHRTTKFALIIRGECSFEDKLLNAQNSGFQA 108 >At5g55630.2 68418.m06937 outward rectifying potassium channel (KCO1) identical to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158 of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 363 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 237 LARSRCCPRRDCTENPSRSV*TPSSRHPESIYRSSD 130 L RSR PR DC N + P HP I SD Sbjct: 37 LRRSRSAPRGDCMYNDDVKIDEPPP-HPSKIPMFSD 71 >At5g55630.1 68418.m06936 outward rectifying potassium channel (KCO1) identical to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158 of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 363 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 237 LARSRCCPRRDCTENPSRSV*TPSSRHPESIYRSSD 130 L RSR PR DC N + P HP I SD Sbjct: 37 LRRSRSAPRGDCMYNDDVKIDEPPP-HPSKIPMFSD 71 >At5g45300.1 68418.m05561 glycosyl hydrolase family 14 protein similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 689 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 217 TTSGAREQLQIHRPNGTRTPGRCRGQPPSGLPRYRSRALTALAV*P 354 TT+G+++ P+ + P R R QP S PR + A A ++ P Sbjct: 10 TTTGSQDPNLDPIPDPDQFPNRNRNQPQSRRPRGFAAAAAAASIAP 55 >At4g34930.1 68417.m04952 1-phosphatidylinositol phosphodiesterase-related contains weak similarity to 1-phosphatidylinositol phosphodiesterase precursor (EC 4.6.1.13) (Phosphatidylinositol diacylglycerol-lyase) (Phosphatidylinositol- specific phospholipase C) (PI-PLC). (Swiss-Prot:P34024) [Listeria monocytogenes] Length = 391 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -2 Query: 272 VRVPLGRCICN---CSRAPDVVLVGIVRRIQAVQSELLHRVIQRAF 144 +R RC+C+ S DVVL ++R + QSE++ I+ F Sbjct: 170 IRFQEDRCVCHGALSSYNVDVVLNDVIRFVSETQSEIIILEIRTEF 215 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 25.8 bits (54), Expect = 8.3 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 204 NPDEDNIWSARAVADTSTQWNTYSRQVSW 290 NP++D I+ ++ +A ++ Q N + + SW Sbjct: 35 NPEKDEIFLSQFMAPSTGQVNEHMEETSW 63 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 25.8 bits (54), Expect = 8.3 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 204 NPDEDNIWSARAVADTSTQWNTYSRQVSW 290 NP++D I+ ++ +A ++ Q N + + SW Sbjct: 35 NPEKDEIFLSQFMAPSTGQVNEHMEETSW 63 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 183 SV*TPSSRHPESIYRSSDWQCWMTWWHSNRKTDLNE 76 SV + S++ ++ SS W C + W++N T E Sbjct: 207 SVQSVSAQKSGNMVCSSSWDCTINLWNTNESTSEGE 242 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 183 SV*TPSSRHPESIYRSSDWQCWMTWWHSNRKTDLNE 76 SV + S++ ++ SS W C + W++N T E Sbjct: 207 SVQSVSAQKSGNMVCSSSWDCTINLWNTNESTSEGE 242 >At3g19910.1 68416.m02521 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 340 Score = 25.8 bits (54), Expect = 8.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 17 SDYGKWELGGFVF 55 SDYG WE G +V+ Sbjct: 121 SDYGSWETGSYVY 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,779,539 Number of Sequences: 28952 Number of extensions: 185063 Number of successful extensions: 647 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -