BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0155 (787 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 28 1.7 SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp... 25 9.3 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 27.9 bits (59), Expect = 1.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 463 NPLWQ*ILYSAKTKQIHYLIFIHCIQMNTRFV 558 +P W LY+ KTK+I L F I+ + +F+ Sbjct: 454 DPNWSNFLYNGKTKKIELLDFGASIEYDEKFI 485 >SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp9|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 25.4 bits (53), Expect = 9.3 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 6/62 (9%) Frame = +3 Query: 543 EYSFRLPINANRSVNEYSLCRLDVLPSHTTM*STGS------HLASRTDRNLVTPPTAVK 704 E+S+ +N N +V E SL +L +PS S L R +++ P + K Sbjct: 54 EFSYSKDVNNNGAVEELSLTQLFEVPSQAAFAKQSSQDISDDELIQHDSRKVISSPYSPK 113 Query: 705 NT 710 T Sbjct: 114 QT 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,139,524 Number of Sequences: 5004 Number of extensions: 67219 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -