BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0155 (787 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0138 + 23067885-23068245,23068393-23068634 32 0.59 05_01_0328 - 2571155-2571627,2571894-2572197 28 9.7 >04_04_0138 + 23067885-23068245,23068393-23068634 Length = 200 Score = 31.9 bits (69), Expect = 0.59 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +3 Query: 558 LPINANRSVNEYSLCRLDVLPSHTTM*STGSHLASRTDRNLVTPPTAVKNTTH*RIPNPI 737 +P+N R+V LCRLD+ P+ T G L V+ P + N+T P P+ Sbjct: 94 VPVNRTRAVQLPLLCRLDLPPAATA--CPGFDLGGAAPSPPVSVPRSTPNSTAPSTPTPV 151 >05_01_0328 - 2571155-2571627,2571894-2572197 Length = 258 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 676 LRSVLDAKWLPVLHIVV*EGSTSNRQREYSLTERLAFIG 560 + VL W P H V G SN REY R IG Sbjct: 207 MEKVLMVSWPPYRHRTVAVGEVSNCSREYDDISRTNLIG 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,978,612 Number of Sequences: 37544 Number of extensions: 348570 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -