BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0155 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 25 2.0 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 24 4.6 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 25.4 bits (53), Expect = 2.0 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +3 Query: 453 ESGQSPLAMNIVFGENKANTLSHFHTLYTNEYSFRLPINANRSVNEYSLCRLDVLP 620 + Q LA + FG + N + F L ++FRL +N CR+ + P Sbjct: 455 QRSQVDLATGLDFGP-EGNVFASFTHLQHAPFTFRLTVNNTSGRTRRGTCRIFIGP 509 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 24.2 bits (50), Expect = 4.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 315 LVLRLIFYINKCRIV 271 L L L+FY+NKC ++ Sbjct: 488 LKLLLVFYVNKCELM 502 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,182 Number of Sequences: 2352 Number of extensions: 17251 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -