BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0152 (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.3 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 9.6 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +2 Query: 572 APHDVWYPSQWTISSPPPRPTLTHSGHVPR 661 +PH +Y S+ + +PP L ++ ++ R Sbjct: 524 SPHHEYYDSKSSTETPPSYNQLNYNENIER 553 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 617 ATISSTAKDXXXXXXXRETLLSSHYLCNAHELRCSDAMCFH 495 AT ++TA +ETL H+L N H S A+ H Sbjct: 119 ATAAATATTTATGLIKQETLQRHHHLQNHHHHLQSTAVQDH 159 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 106 VRIHHFISTLVEIRIPVTA 50 +RIHH S IR+ +TA Sbjct: 118 IRIHHSGSITRSIRLTITA 136 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 106 VRIHHFISTLVEIRIPVTA 50 +RIHH S IR+ +TA Sbjct: 118 IRIHHSGSITRSIRLTITA 136 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 106 VRIHHFISTLVEIRIPVTA 50 +RIHH S IR+ +TA Sbjct: 57 IRIHHSGSITRSIRLTITA 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,220 Number of Sequences: 438 Number of extensions: 3716 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -