BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0150 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.58 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 4.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.4 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 249 QHSCRSFRGGTNKNSRCRYGY*KDRCTADS 160 Q C + G N+ C Y KD C DS Sbjct: 320 QVECYKYYGNIMVNAMCAYAKGKDACQMDS 349 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/26 (26%), Positives = 13/26 (50%) Frame = +2 Query: 458 HRQDDRSIARTSQPPLVEVNPIRYHH 535 H Q +A +S P +++ +HH Sbjct: 441 HHQHSTPLAHSSYPAAIQIGHTPHHH 466 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 252 ATFPYLTASKSVCKKEKK 305 A P + ++ S CKK+KK Sbjct: 568 ARTPSVMSASSTCKKDKK 585 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,591 Number of Sequences: 438 Number of extensions: 3372 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -