BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0149 (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 36 0.001 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 26 1.2 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 26 1.2 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 26 1.2 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 26 1.2 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 26 1.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 26 1.5 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 26 1.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 26 1.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 26 1.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 26 1.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 26 1.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 26 1.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 25 2.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.0 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 2.7 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 25 3.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 6.2 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 8.2 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 23 8.2 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 23 8.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 8.2 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 35.9 bits (79), Expect = 0.001 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 247 KGSYSYIDPSGQRKTVNYIAG-KNGFQAV 330 +GSYS +DP G ++TV+Y A NGF AV Sbjct: 50 QGSYSVVDPDGTKRTVDYTADPHNGFNAV 78 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 10/86 (11%) Frame = +2 Query: 413 TRHHNIVRHNNTSRKHSPVTTAASPMKTTDSTIL------SYTNKRTTQLH----NRDIS 562 T ++N +NN S + V + +S ++S++L S T TT + N + Sbjct: 97 TNNNNNNNNNNGSNTGATVNSGSSNAALSNSSVLNGSNSGSATTTTTTPTNPGNGNGGSN 156 Query: 563 LNNSTKLSHNIKPSLSRNTNHNLNTS 640 NN++ S + +S NTN+N T+ Sbjct: 157 NNNNSNSSSSCNNHVSSNTNNNGTTN 182 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 58 VIVAVSCQQHEGARRVPKYAGDPKTAAIVQEARYLSGNGAFGAAYQQEDGINFKEETDAE 237 V A + QH A + K P V+ + ++ + I + ET Sbjct: 49 VHAAPAIYQHS-APAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHG 107 Query: 238 GNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 G YS +D G ++ V+Y A + GF AV Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 58 VIVAVSCQQHEGARRVPKYAGDPKTAAIVQEARYLSGNGAFGAAYQQEDGINFKEETDAE 237 V A + QH A + K P V+ + ++ + I + ET Sbjct: 49 VHAAPAIYQHS-APAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHG 107 Query: 238 GNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 G YS +D G ++ V+Y A + GF AV Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 58 VIVAVSCQQHEGARRVPKYAGDPKTAAIVQEARYLSGNGAFGAAYQQEDGINFKEETDAE 237 V A + QH A + K P V+ + ++ + I + ET Sbjct: 49 VHAAPAIYQHS-APAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHG 107 Query: 238 GNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 G YS +D G ++ V+Y A + GF AV Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 26.2 bits (55), Expect = 1.2 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 58 VIVAVSCQQHEGARRVPKYAGDPKTAAIVQEARYLSGNGAFGAAYQQEDGINFKEETDAE 237 V A + QH A + K P V+ + ++ + I + ET Sbjct: 49 VHAAPAIYQHS-APAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHG 107 Query: 238 GNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 G YS +D G ++ V+Y A + GF AV Sbjct: 108 DEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +2 Query: 578 KLSHNIKPSLSRNTNHNLNTSLNPSPGI 661 +L H+ +P LS++++H+ ++ P+P I Sbjct: 1329 QLQHHHQPQLSQSSHHSSSSHGGPTPSI 1356 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 98 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 98 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 130 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 171 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 147 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.4 bits (53), Expect = 2.0 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G + V+Y A + GF AV Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAV 147 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.4 bits (53), Expect = 2.0 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 208 INFKEETDAEGNRKGSYSYIDPSGQRKTVNYIAGKN-GFQAV 330 I + ET G YS +D G ++ V+Y A + GF AV Sbjct: 98 IKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAV 139 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 67 AVSCQ-QHEGARRVPKYAGDPKTAAIVQEAR 156 A SCQ QH+ R P YA + A+ Q +R Sbjct: 109 ARSCQYQHDSCRNTPVYAWAGQNIALAQFSR 139 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 436 AHYIVVPCNLESCIEDRACSQE*ERQLEAQSECDRQRLGIHFC 308 AH ++ +E+C+ S + +A C++ R G+ FC Sbjct: 129 AHCPLIGMEVENCLHRTTFSNCPNSRWKASITCNKVRQGLPFC 171 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 6.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 472 SYGAVLARRIVVAHYIVVPCNLESCIEDRACSQE*ERQLEAQ 347 +YG LA V + PC LE C ++RA +E L A+ Sbjct: 534 AYGMALAD---VVYETQEPCGLELCPDNRAALKERLHALSAR 572 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.4 bits (48), Expect = 8.2 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +2 Query: 461 SPVTTAASPMKTTDSTILSYTNKRTTQLH 547 +P+TT S + + S + +YT + ++H Sbjct: 328 NPLTTNRSAVDSLSSNLWNYTKRHLARMH 356 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 8.2 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -3 Query: 616 IAAEAGLDIVAEL--GTVVEADISVVELRSSLVRIAQDSTVRRLHWACRR 473 ++A GLD E+ AD V + S R ++ +R L+WAC + Sbjct: 17 VSASGGLDDALEVTFSERTRADWEKVWHQESHSR-CREKLIRHLYWACEK 65 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 8.2 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -3 Query: 616 IAAEAGLDIVAEL--GTVVEADISVVELRSSLVRIAQDSTVRRLHWACRR 473 ++A GLD E+ AD V + S R ++ +R L+WAC + Sbjct: 17 VSASGGLDDALEVTFSERTRADWEKVWHQESHSR-CREKLIRHLYWACEK 65 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 8.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 706 QQAQYSGLQTQQEYSAPETRSQYYEPTTP 792 QQ Q Q QQ++ P T++Q P+ P Sbjct: 1313 QQQQQQQQQQQQQHQPPSTQAQ-LRPSAP 1340 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.314 0.132 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,064 Number of Sequences: 2352 Number of extensions: 15854 Number of successful extensions: 65 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -