BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0147 (832 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070987-1|AAL48609.1| 252|Drosophila melanogaster RE08075p pro... 42 8e-04 AE014297-3562|AAF56308.2| 252|Drosophila melanogaster CG13618-P... 42 8e-04 AY089660-1|AAL90398.1| 262|Drosophila melanogaster RH24258p pro... 39 0.007 AF145628-1|AAD38603.1| 262|Drosophila melanogaster BcDNA.GH0553... 39 0.007 AE014134-2310|AAF53270.1| 262|Drosophila melanogaster CG5867-PA... 39 0.007 BT023411-1|AAY55827.1| 250|Drosophila melanogaster IP10429p pro... 38 0.013 AE014297-3745|AAF56426.1| 250|Drosophila melanogaster CG11854-P... 38 0.013 AE013599-4031|AAZ52800.1| 278|Drosophila melanogaster CG33680-P... 37 0.029 AY122123-1|AAM52635.1| 250|Drosophila melanogaster GH20621p pro... 37 0.039 AE014134-2311|AAF53271.1| 250|Drosophila melanogaster CG5945-PA... 37 0.039 BT023318-1|AAY55734.1| 255|Drosophila melanogaster IP10158p pro... 34 0.27 AY122096-1|AAM52608.1| 252|Drosophila melanogaster GH05615p pro... 34 0.27 AF261748-1|AAF79960.1| 249|Drosophila melanogaster TAKEOUT prot... 34 0.27 AE014297-3744|AAF56425.2| 249|Drosophila melanogaster CG11853-P... 34 0.27 AE014297-2912|AAF55837.1| 255|Drosophila melanogaster CG7079-PA... 34 0.27 AY119063-1|AAM50923.1| 250|Drosophila melanogaster LP07620p pro... 32 0.84 AE014297-3743|AAF56423.2| 250|Drosophila melanogaster CG11852-P... 32 0.84 AE014297-2138|AAF55266.1| 259|Drosophila melanogaster CG10407-P... 32 1.1 X76206-1|CAA53799.1| 265|Drosophila melanogaster hypothetical p... 31 1.9 AY071726-1|AAL49348.1| 260|Drosophila melanogaster RH43234p pro... 31 1.9 AY048042-2|AAN02412.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048041-2|AAN02410.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048040-2|AAN02408.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048038-2|AAN02406.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048037-2|AAN02404.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048036-2|AAN02402.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048035-2|AAN02400.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048034-2|AAN02398.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048033-2|AAN02396.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048032-2|AAN02394.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048031-2|AAN02392.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048030-2|AAN02390.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048029-2|AAN02388.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048028-2|AAN02386.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048027-2|AAN02384.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048026-2|AAN02382.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048025-2|AAN02380.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048024-2|AAN02378.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048023-2|AAN02376.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048022-2|AAN02374.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048021-2|AAN02372.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048020-2|AAN02370.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048019-2|AAN02368.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048018-2|AAN02366.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048017-2|AAN02364.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048016-2|AAN02362.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048015-2|AAN02360.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048014-2|AAN02358.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048013-2|AAN02356.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048012-2|AAN02354.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048011-2|AAN02352.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048010-2|AAN02350.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048009-2|AAN02348.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY048008-2|AAN02346.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048007-2|AAN02344.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048005-2|AAN02340.1| 102|Drosophila melanogaster period protein. 31 1.9 AY048001-2|AAN02332.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047999-2|AAN02328.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047998-2|AAN02326.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047997-2|AAN02324.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047996-2|AAN02322.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047995-2|AAN02320.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047993-2|AAN02316.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047992-2|AAN02314.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047991-2|AAN02312.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047990-2|AAN02310.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047989-2|AAN02308.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047988-2|AAN02306.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047987-2|AAN02304.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047986-2|AAN02302.1| 102|Drosophila melanogaster period protein. 31 1.9 AY047984-2|AAN02298.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047983-2|AAN02296.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047982-2|AAN02294.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047981-2|AAN02292.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AY047980-2|AAN02290.1| 102|Drosophila melanogaster CG2650 protein. 31 1.9 AE014298-441|AAF45805.2| 260|Drosophila melanogaster CG2650-PA ... 31 1.9 BT023563-1|AAY84963.1| 250|Drosophila melanogaster IP09672p pro... 30 3.4 BT023551-1|AAY84951.1| 256|Drosophila melanogaster IP09772p pro... 30 3.4 BT023537-1|AAY84937.1| 256|Drosophila melanogaster IP09872p pro... 30 3.4 BT023522-1|AAY84922.1| 256|Drosophila melanogaster IP09972p pro... 30 3.4 AY071299-1|AAL48921.1| 249|Drosophila melanogaster RE32803p pro... 30 3.4 AE014297-2910|AAF55836.3| 261|Drosophila melanogaster CG31189-P... 30 3.4 AE014297-174|AAF52077.1| 249|Drosophila melanogaster CG2016-PB ... 30 3.4 BT024348-1|ABC86410.1| 289|Drosophila melanogaster IP09473p pro... 30 4.5 AE014297-4065|AAF56663.1| 289|Drosophila melanogaster CG14259-P... 30 4.5 BT023162-1|AAY55578.1| 320|Drosophila melanogaster IP09405p pro... 29 7.8 AE014297-2137|AAF55265.1| 270|Drosophila melanogaster CG10264-P... 29 7.8 >AY070987-1|AAL48609.1| 252|Drosophila melanogaster RE08075p protein. Length = 252 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/45 (46%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +1 Query: 28 FLNQNWRVLYREL-LPYAQSNWDKIGTNVANKIFSKVPYDQIFPS 159 FLN+NW ++ EL + YA+S + I ++NK+F KVP+D IF S Sbjct: 209 FLNENWETVFNELKVGYAKS-FGIIFRELSNKLFEKVPFDNIFLS 252 >AE014297-3562|AAF56308.2| 252|Drosophila melanogaster CG13618-PA protein. Length = 252 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/45 (46%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +1 Query: 28 FLNQNWRVLYREL-LPYAQSNWDKIGTNVANKIFSKVPYDQIFPS 159 FLN+NW ++ EL + YA+S + I ++NK+F KVP+D IF S Sbjct: 209 FLNENWETVFNELKVGYAKS-FGIIFRELSNKLFEKVPFDNIFLS 252 >AY089660-1|AAL90398.1| 262|Drosophila melanogaster RH24258p protein. Length = 262 Score = 39.1 bits (87), Expect = 0.007 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 7 LTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQI 150 L ++ F+NQ WR LY+ +LP W + N F+ +P+D + Sbjct: 211 LNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDML 258 >AF145628-1|AAD38603.1| 262|Drosophila melanogaster BcDNA.GH05536 protein. Length = 262 Score = 39.1 bits (87), Expect = 0.007 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 7 LTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQI 150 L ++ F+NQ WR LY+ +LP W + N F+ +P+D + Sbjct: 211 LNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDML 258 >AE014134-2310|AAF53270.1| 262|Drosophila melanogaster CG5867-PA protein. Length = 262 Score = 39.1 bits (87), Expect = 0.007 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 7 LTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQI 150 L ++ F+NQ WR LY+ +LP W + N F+ +P+D + Sbjct: 211 LNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDML 258 >BT023411-1|AAY55827.1| 250|Drosophila melanogaster IP10429p protein. Length = 250 Score = 38.3 bits (85), Expect = 0.013 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++L+ + +N+NW+ ++ EL P + I +V ++IF K+P +Q+F Sbjct: 198 KDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248 >AE014297-3745|AAF56426.1| 250|Drosophila melanogaster CG11854-PA protein. Length = 250 Score = 38.3 bits (85), Expect = 0.013 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++L+ + +N+NW+ ++ EL P + I +V ++IF K+P +Q+F Sbjct: 198 KDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248 >AE013599-4031|AAZ52800.1| 278|Drosophila melanogaster CG33680-PA protein. Length = 278 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIFPSG 162 R L ++G S +N N + +++ P + K +VA+KI + +D++FP G Sbjct: 177 RFLGDVGNSLINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDEMFPPG 230 >AY122123-1|AAM52635.1| 250|Drosophila melanogaster GH20621p protein. Length = 250 Score = 36.7 bits (81), Expect = 0.039 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQ 147 EL + + NQ WR +Y +LP + W + + N+ F VP DQ Sbjct: 199 ELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQ 246 >AE014134-2311|AAF53271.1| 250|Drosophila melanogaster CG5945-PA protein. Length = 250 Score = 36.7 bits (81), Expect = 0.039 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQ 147 EL + + NQ WR +Y +LP + W + + N+ F VP DQ Sbjct: 199 ELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQ 246 >BT023318-1|AAY55734.1| 255|Drosophila melanogaster IP10158p protein. Length = 255 Score = 33.9 bits (74), Expect = 0.27 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +LT + N+NW + EL P ++ + ++ +F KVPYD +F Sbjct: 199 DLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLF 248 >AY122096-1|AAM52608.1| 252|Drosophila melanogaster GH05615p protein. Length = 252 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 FLN+N +Y+E ++ K+ V +FSK+PY + F Sbjct: 207 FLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 248 >AF261748-1|AAF79960.1| 249|Drosophila melanogaster TAKEOUT protein. Length = 249 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 FLN+N +Y+E ++ K+ V +FSK+PY + F Sbjct: 204 FLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245 >AE014297-3744|AAF56425.2| 249|Drosophila melanogaster CG11853-PA protein. Length = 249 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 FLN+N +Y+E ++ K+ V +FSK+PY + F Sbjct: 204 FLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245 >AE014297-2912|AAF55837.1| 255|Drosophila melanogaster CG7079-PA protein. Length = 255 Score = 33.9 bits (74), Expect = 0.27 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +LT + N+NW + EL P ++ + ++ +F KVPYD +F Sbjct: 199 DLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLF 248 >AY119063-1|AAM50923.1| 250|Drosophila melanogaster LP07620p protein. Length = 250 Score = 32.3 bits (70), Expect = 0.84 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 10 TNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 TNL FLN NW ++ EL P +I +V +++F + Y+ +F Sbjct: 201 TNLN-QFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLF 247 >AE014297-3743|AAF56423.2| 250|Drosophila melanogaster CG11852-PA protein. Length = 250 Score = 32.3 bits (70), Expect = 0.84 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 10 TNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 TNL FLN NW ++ EL P +I +V +++F + Y+ +F Sbjct: 201 TNLN-QFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLF 247 >AE014297-2138|AAF55266.1| 259|Drosophila melanogaster CG10407-PA protein. Length = 259 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIFP 156 FLN+NW+ L E+ P I +K+F+ YD + P Sbjct: 216 FLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDLLP 258 >X76206-1|CAA53799.1| 265|Drosophila melanogaster hypothetical protein protein. Length = 265 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 212 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 262 >AY071726-1|AAL49348.1| 260|Drosophila melanogaster RH43234p protein. Length = 260 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 207 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257 >AY048042-2|AAN02412.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048041-2|AAN02410.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048040-2|AAN02408.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048038-2|AAN02406.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048037-2|AAN02404.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048036-2|AAN02402.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048035-2|AAN02400.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048034-2|AAN02398.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048033-2|AAN02396.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048032-2|AAN02394.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048031-2|AAN02392.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048030-2|AAN02390.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048029-2|AAN02388.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048028-2|AAN02386.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048027-2|AAN02384.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048026-2|AAN02382.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048025-2|AAN02380.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048024-2|AAN02378.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048023-2|AAN02376.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048022-2|AAN02374.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048021-2|AAN02372.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048020-2|AAN02370.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048019-2|AAN02368.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048018-2|AAN02366.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048017-2|AAN02364.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048016-2|AAN02362.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048015-2|AAN02360.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048014-2|AAN02358.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048013-2|AAN02356.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048012-2|AAN02354.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048011-2|AAN02352.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048010-2|AAN02350.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048009-2|AAN02348.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048008-2|AAN02346.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048007-2|AAN02344.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048005-2|AAN02340.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY048001-2|AAN02332.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047999-2|AAN02328.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047998-2|AAN02326.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047997-2|AAN02324.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047996-2|AAN02322.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047995-2|AAN02320.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047993-2|AAN02316.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047992-2|AAN02314.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047991-2|AAN02312.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047990-2|AAN02310.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047989-2|AAN02308.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047988-2|AAN02306.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047987-2|AAN02304.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047986-2|AAN02302.1| 102|Drosophila melanogaster period protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047984-2|AAN02298.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047983-2|AAN02296.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047982-2|AAN02294.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047981-2|AAN02292.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AY047980-2|AAN02290.1| 102|Drosophila melanogaster CG2650 protein. Length = 102 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 49 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 99 >AE014298-441|AAF45805.2| 260|Drosophila melanogaster CG2650-PA protein. Length = 260 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 +EL + LNQ W L ++ P K + + +++ +PYD+ F Sbjct: 207 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257 >BT023563-1|AAY84963.1| 250|Drosophila melanogaster IP09672p protein. Length = 250 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++T N+NW + +L P + T + N++F V YD +F Sbjct: 191 DVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 240 >BT023551-1|AAY84951.1| 256|Drosophila melanogaster IP09772p protein. Length = 256 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++T N+NW + +L P + T + N++F V YD +F Sbjct: 197 DVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 246 >BT023537-1|AAY84937.1| 256|Drosophila melanogaster IP09872p protein. Length = 256 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++T N+NW + +L P + T + N++F V YD +F Sbjct: 197 DVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 246 >BT023522-1|AAY84922.1| 256|Drosophila melanogaster IP09972p protein. Length = 256 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++T N+NW + +L P + T + N++F V YD +F Sbjct: 197 DVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 246 >AY071299-1|AAL48921.1| 249|Drosophila melanogaster RE32803p protein. Length = 249 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQ 147 F+N N + L +E+ P ++ + N ++IF+K+P D+ Sbjct: 205 FINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDE 244 >AE014297-2910|AAF55836.3| 261|Drosophila melanogaster CG31189-PA protein. Length = 261 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 4 ELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIF 153 ++T N+NW + +L P + T + N++F V YD +F Sbjct: 202 DVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 251 >AE014297-174|AAF52077.1| 249|Drosophila melanogaster CG2016-PB protein. Length = 249 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 28 FLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQ 147 F+N N + L +E+ P ++ + N ++IF+K+P D+ Sbjct: 205 FINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDE 244 >BT024348-1|ABC86410.1| 289|Drosophila melanogaster IP09473p protein. Length = 289 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVP 138 +E+ F N+NWR Y L P + I +V + +F +P Sbjct: 219 KEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIP 264 >AE014297-4065|AAF56663.1| 289|Drosophila melanogaster CG14259-PA protein. Length = 289 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVP 138 +E+ F N+NWR Y L P + I +V + +F +P Sbjct: 219 KEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIP 264 >BT023162-1|AAY55578.1| 320|Drosophila melanogaster IP09405p protein. Length = 320 Score = 29.1 bits (62), Expect = 7.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 25 SFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVP 138 SFLNQN + + EL P + I + N +FSK+P Sbjct: 277 SFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSKMP 314 >AE014297-2137|AAF55265.1| 270|Drosophila melanogaster CG10264-PA protein. Length = 270 Score = 29.1 bits (62), Expect = 7.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 25 SFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVP 138 SFLNQN + + EL P + I + N +FSK+P Sbjct: 227 SFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSKMP 264 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,316,907 Number of Sequences: 53049 Number of extensions: 652578 Number of successful extensions: 1263 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3942192384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -