BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0147 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 44 2e-06 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 8.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 8.0 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 44.0 bits (99), Expect = 2e-06 Identities = 18/52 (34%), Positives = 33/52 (63%) Frame = +1 Query: 1 RELTNLGTSFLNQNWRVLYRELLPYAQSNWDKIGTNVANKIFSKVPYDQIFP 156 +EL F+N+N +L++EL + + + T + N+IF++VP+D+IFP Sbjct: 200 KELGEQMNRFINENSELLFKELQAAYEETFSLVFTKIDNEIFNRVPFDKIFP 251 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 543 DNILIGSRCQIYLNHF 590 +N+L GSR QIY+ + Sbjct: 1425 ENLLCGSRYQIYVTAY 1440 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 Query: 629 FGQFWCMGWL*KIAW 673 FG WC WL W Sbjct: 133 FGDLWCSIWLAVDVW 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,018 Number of Sequences: 438 Number of extensions: 4646 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -