BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0146 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 25 0.79 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 24 1.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 1.8 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 4.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 4.2 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 24.6 bits (51), Expect = 0.79 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +2 Query: 419 DFNLSSEDMNKIGTFNKEKRTVGMSFWQDHPYYPFEKSDQVHD 547 DF S D + +E + + W H YPFE + ++ D Sbjct: 182 DFTASDLDEEHRVAYWREDIGLNLHHWHWHLVYPFEGAREIVD 224 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 353 KGVVPIPKSVKKNRIEENIDVFDFN 427 K ++ I +KKN ++N DVF F+ Sbjct: 130 KSLIYIDMIIKKNVTQQNSDVFIFD 154 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 299 QWPRAWGRRGVLRVSCRGTSGRTG 228 QWP AWG + R S TS TG Sbjct: 80 QWPFAWG--SLXRSSSPQTSAPTG 101 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 167 LGQDKLIDYCKRNGIVVMAFSPFGPMFHDSLP 262 LG++ + R+ I M S PM HD LP Sbjct: 342 LGENMMDMSLTRHQISSMGHSHAHPMHHDMLP 373 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 167 LGQDKLIDYCKRNGIVVMAFSPFGPMFHDSLP 262 LG++ + R+ I M S PM HD LP Sbjct: 342 LGENMMDMSLTRHQISSMGHSHAHPMHHDMLP 373 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,721 Number of Sequences: 336 Number of extensions: 3473 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -