Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0145
         (767 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0227 - 14485676-14487316                                         28   9.4  

>08_02_0227 - 14485676-14487316
          Length = 546

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = +1

Query: 364 YSNTMQKTNIWFCIRKYTCSTFKRCLFLIQ*INCVMFFEHLYENMITPI*LPINIRAPT- 540
           + N+++K  + F   K TCS  +  +FL++  N  +  E   +     +   IN +  T 
Sbjct: 442 WKNSLRKVTVQFQKGKLTCSQVELVMFLVE--NAAVLEEFDIDGESQDVTDQINTKIATW 499

Query: 541 -KRKSNNREKKTN 576
             R S++REK+ +
Sbjct: 500 RARSSSSREKEAH 512


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,661,522
Number of Sequences: 37544
Number of extensions: 289763
Number of successful extensions: 436
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 430
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 436
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2063219900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)