BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0145 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 2.6 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 3.4 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 2.6 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -3 Query: 417 GIFANAKPNISFLHCVTIKI*NGHVFAFYDSQYIHYFTKFLYMNS 283 G + N K NI + + T + FY +Y++Y+T+ + +N+ Sbjct: 190 GFYGNGKYNIVYAN-YTATYPMDYYNNFYTEEYLNYYTEDIGLNA 233 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 337 CKNVSILYLYSNTMQKTNIWFCIRKY 414 C+ L+ ++++T IW CI KY Sbjct: 507 CELAQELHRQGLSLEQTAIWVCIAKY 532 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,445 Number of Sequences: 2352 Number of extensions: 14028 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -