BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0145 (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.8 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 3.1 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 9.5 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 217 LTKVFKTNLKQ*P*ASIKIRRTI 149 L KVFK L+ P ASI +R+ I Sbjct: 356 LDKVFKETLRMYPPASILMRKAI 378 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 561 SVITFSFSWCTNVYW*LYGGNHIFI*MFEKHYTINLLN 448 +V T++ + T + LYGGN I + + + +LLN Sbjct: 111 TVFTYNITNSTPLLKKLYGGNSTIIFLLIRFKSFSLLN 148 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 90 ERLNYNTYDMIY*SDLHKQGWFEGFH 13 ERL Y + S++ K WF+GF+ Sbjct: 608 ERLGYQKGGI---SEIQKHKWFDGFN 630 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 237 SNSSIHFSQIFEFMIKNSCIEI**NNVYID 326 SN +IH + +++ N+C ++ N YI+ Sbjct: 86 SNKTIHNNNNYKYNYNNNCKKLYYNINYIE 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,750 Number of Sequences: 438 Number of extensions: 4139 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -