BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0143 (361 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 40 5e-04 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 38 0.002 At3g10530.1 68416.m01264 transducin family protein / WD-40 repea... 38 0.003 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 37 0.005 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 36 0.006 At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf... 36 0.006 At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf... 36 0.006 At3g45620.1 68416.m04927 transducin family protein / WD-40 repea... 36 0.011 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 35 0.014 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 35 0.014 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 35 0.014 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 35 0.014 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 35 0.014 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 35 0.014 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 35 0.019 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 35 0.019 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 35 0.019 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 35 0.019 At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul... 34 0.025 At3g49180.1 68416.m05375 transducin family protein / WD-40 repea... 34 0.025 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 34 0.025 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 34 0.025 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 34 0.025 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 34 0.033 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 34 0.033 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 34 0.033 At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 34 0.033 At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul... 34 0.033 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 34 0.033 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 33 0.043 At4g38480.1 68417.m05438 transducin family protein / WD-40 repea... 33 0.043 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 33 0.043 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 33 0.043 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 33 0.043 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 33 0.043 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 33 0.043 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 33 0.043 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 33 0.043 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 33 0.057 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 33 0.057 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 33 0.057 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 33 0.075 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 33 0.075 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 33 0.075 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 33 0.075 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 33 0.075 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 33 0.075 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 33 0.075 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 33 0.075 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 32 0.100 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 32 0.100 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 32 0.100 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 32 0.100 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 32 0.13 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 32 0.13 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 32 0.13 At1g15850.1 68414.m01902 transducin family protein / WD-40 repea... 32 0.13 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 32 0.13 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 31 0.17 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 31 0.17 At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf... 31 0.23 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 31 0.23 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 31 0.23 At4g35140.1 68417.m04996 transducin family protein / WD-40 repea... 31 0.23 At4g29380.1 68417.m04197 protein kinase family protein / WD-40 r... 31 0.23 At4g02730.1 68417.m00372 transducin family protein / WD-40 repea... 31 0.23 At1g80670.1 68414.m09466 transducin family protein / WD-40 repea... 31 0.23 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 31 0.23 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 31 0.23 At4g34380.1 68417.m04884 transducin family protein / WD-40 repea... 31 0.30 At3g18860.2 68416.m02396 transducin family protein / WD-40 repea... 31 0.30 At3g18860.1 68416.m02395 transducin family protein / WD-40 repea... 31 0.30 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 31 0.30 At1g04510.1 68414.m00442 transducin family protein / WD-40 repea... 31 0.30 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 30 0.40 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 30 0.40 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 30 0.40 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 30 0.40 At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 30 0.40 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 30 0.40 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 30 0.40 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 30 0.40 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 30 0.53 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 30 0.53 At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha... 30 0.53 At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha... 30 0.53 At1g24530.1 68414.m03088 transducin family protein / WD-40 repea... 30 0.53 At4g28450.1 68417.m04071 transducin family protein / WD-40 repea... 29 0.70 At4g01860.2 68417.m00244 transducin family protein / WD-40 repea... 29 0.70 At4g01860.1 68417.m00243 transducin family protein / WD-40 repea... 29 0.70 At3g06880.1 68416.m00817 transducin family protein / WD-40 repea... 29 0.70 At2g16405.1 68415.m01878 transducin family protein / WD-40 repea... 29 0.70 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 29 0.70 At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochro... 29 0.70 At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochro... 29 0.70 At5g10940.1 68418.m01269 transducin family protein / WD-40 repea... 29 0.93 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 29 0.93 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 0.93 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 29 0.93 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 29 0.93 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 1.2 At1g52730.2 68414.m05959 transducin family protein / WD-40 repea... 29 1.2 At1g52730.1 68414.m05958 transducin family protein / WD-40 repea... 29 1.2 At1g51690.2 68414.m05825 serine/threonine protein phosphatase 2A... 29 1.2 At1g51690.1 68414.m05824 serine/threonine protein phosphatase 2A... 29 1.2 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 28 1.6 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 28 1.6 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 28 1.6 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 28 1.6 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 28 1.6 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 28 1.6 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 28 1.6 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 28 2.1 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 28 2.1 At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 28 2.1 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 28 2.1 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 28 2.1 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 28 2.1 At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 pro... 27 2.8 At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 27 2.8 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 27 2.8 At3g50390.1 68416.m05512 transducin family protein / WD-40 repea... 27 2.8 At2g46560.1 68415.m05808 transducin family protein / WD-40 repea... 27 2.8 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 27 2.8 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 27 3.8 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 27 3.8 At3g20740.1 68416.m02624 fertilization-independent endosperm pro... 27 3.8 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 27 5.0 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 27 5.0 At1g64350.1 68414.m07292 transducin family protein / WD-40 repea... 27 5.0 At5g26270.1 68418.m03135 expressed protein ; expression support... 26 6.6 At4g21080.1 68417.m03048 Dof-type zinc finger domain-containing ... 26 6.6 At3g15610.1 68416.m01980 transducin family protein / WD-40 repea... 26 6.6 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 26 6.6 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 26 6.6 At5g60070.1 68418.m07532 ankyrin repeat family protein contains ... 26 8.7 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 26 8.7 At1g74770.1 68414.m08663 expressed protein 26 8.7 At1g61680.1 68414.m06957 terpene synthase/cyclase family protein... 26 8.7 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 39.9 bits (89), Expect = 5e-04 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 329 SGVLRQWNMLTVAQN-A*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 SGV + W M V A L H D+ F + L TAS DRT K+WK Sbjct: 276 SGVTKLWEMPQVTNTIAVLKDHKERATDVVFSPVDDCLATASADRTAKLWK 326 Score = 27.5 bits (58), Expect = 2.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H+ + + S+ + T S DRT+K+W Sbjct: 504 LAGHESKVASLDITADSSCIATVSHDRTIKLW 535 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 37.9 bits (84), Expect = 0.002 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 ++AH+G I F+ S TL T +DR VK+W +L Sbjct: 227 IHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTL 265 >At3g10530.1 68416.m01264 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); BING4 (gi:3811380) {Mus musculus]; similar to hypothetical protein GB:P40055 [Saccharomyces cerevisiae] Length = 536 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/72 (22%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 NS++ + G + W + A + H G ++ + F + + T+ ++R +K+W L Sbjct: 251 NSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDL 310 Query: 176 TQ-ASLRSICSF 144 + +++I SF Sbjct: 311 RKFEEVQTIHSF 322 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 36.7 bits (81), Expect = 0.005 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 W++ T HDG +N + F+++S+ +++A DR+++VW S+ + Sbjct: 87 WDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPV 139 Score = 33.1 bits (72), Expect = 0.057 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = -3 Query: 356 NSLLXIXEGS--GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 NS + GS G++ W+++ + AHD + + + + +LT+S D T++VW Sbjct: 238 NSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVVTSVSYHPKEDCMLTSSVDGTIRVW 297 Query: 182 K 180 K Sbjct: 298 K 298 Score = 30.3 bits (65), Expect = 0.40 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H+G++ F+ N LT +DRT+++W Sbjct: 14 LKGHEGAVLAARFNGDGNYALTCGKDRTIRLW 45 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 36.3 bits (80), Expect = 0.006 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -3 Query: 335 EGSGVLRQW--NMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 + G L+ W NM V N AH SI D+ F + + S+D TVKVW T+ Sbjct: 184 DDGGTLKYWQNNMNNVKANK--TAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDFTK 238 Score = 29.1 bits (62), Expect = 0.93 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 NAHD S+ D+ + L + S D T K W Sbjct: 393 NAHDNSVWDLAWHPIGYLLCSGSNDHTTKFW 423 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -3 Query: 329 SGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 SG WN + L AHD I + + N +++ + T+K W+ Sbjct: 144 SGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQ 193 >At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1135 Score = 36.3 bits (80), Expect = 0.006 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 ++AH G++ND+ F + + L +T ED+T+KVW Sbjct: 460 IDAHAGNVNDLAFSQPNQQLCVVTCGEDKTIKVW 493 >At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1137 Score = 36.3 bits (80), Expect = 0.006 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 ++AH G++ND+ F + + L +T ED+T+KVW Sbjct: 460 IDAHAGNVNDLAFSQPNQQLCVVTCGEDKTIKVW 493 >At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus];Human (H326) translated mRNA - Homo sapiens, EMBL:HS06631 Length = 481 Score = 35.5 bits (78), Expect = 0.011 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 LN H+G +N + F+ + L++ S+DR + +W S Sbjct: 51 LNGHEGCVNAVEFNSTGDVLVSGSDDRQIMLWNWLSGS 88 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 L AH+G I A+ L TAS D+TVK+W + L + Sbjct: 207 LQAHNGHILKCLLSPANKYLATASSDKTVKIWNVDGFKLEKV 248 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 23/60 (38%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 N L ++ WN+ L H + D F L+TAS D T ++W + Sbjct: 223 NKYLATASSDKTVKIWNVDGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSM 282 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 ++H ++ + F + + + SED TVK+W L Sbjct: 75 DSHTNNVMAVGFQCDAKWMYSGSEDGTVKIWDL 107 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 WNM T+ + H I D+ F S L T+S D+T+K+W Sbjct: 535 WNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIW 577 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 WNM T+ + H I D+ F S L T+S D+T+K+W Sbjct: 537 WNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIW 579 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 WNM T+ + H I D+ F S L T+S D+T+K+W Sbjct: 537 WNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIW 579 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 WNM T+ + H I D+ F S L T+S D+T+K+W Sbjct: 537 WNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIW 579 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 WNM T+ + H I D+ F S L T+S D+T+K+W Sbjct: 537 WNMETLQVESTPEEHAHIITDVRFRPNSTQLATSSFDKTIKIW 579 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 34.7 bits (76), Expect = 0.019 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -3 Query: 278 LNAHDGSINDIYFD-EASNTLLTASEDRTVKVWKLT 174 +N HD + + ++ A N L T S+DRTVK+W L+ Sbjct: 365 INGHDEAATSVSYNISAPNLLATGSKDRTVKLWDLS 400 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 34.7 bits (76), Expect = 0.019 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 H+ I+D+ F + +++AS+D+T+K+W + SL Sbjct: 70 HENGISDVAFSSDARFIVSASDDKTLKLWDVETGSL 105 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 34.7 bits (76), Expect = 0.019 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 Q+ ++AH G +NDI F + L +T +D+T+KVW Sbjct: 454 QHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVW 491 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 34.7 bits (76), Expect = 0.019 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 Q+ ++AH G +NDI F + L +T +D+T+KVW Sbjct: 454 QHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVW 491 >At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regulator 1 (PRL1) identical to PP1/PP2A phosphatases pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis thaliana], PRL1 [Arabidopsis thaliana] GI:577733; contains Pfam PF00400: WD domain, G-beta repeat (7 copies) Length = 486 Score = 34.3 bits (75), Expect = 0.025 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 V R W++ T Q L+ HD ++ ++ ++T S D T+K W L Sbjct: 283 VCRVWDIRTKMQIFALSGHDNTVCSVFTRPTDPQVVTGSHDTTIKFWDL 331 Score = 33.1 bits (72), Expect = 0.057 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLR 159 + H G + + FD ++ T S DRT+K+W + L+ Sbjct: 172 IQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLK 211 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 299 TVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 T+ Q L + G I +D + L+T D+T+K+WK Sbjct: 425 TIVQPGSLESEAG-IYAACYDNTGSRLVTCEADKTIKMWK 463 >At3g49180.1 68416.m05375 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); GTP-binding protein beta chain homolog, Nicotiana tabacum, PIR:T16970 Length = 438 Score = 34.3 bits (75), Expect = 0.025 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -3 Query: 275 NAHDGSINDIYFDEA--SNTLLTASEDRTVKVWKLTQASL 162 N H S+ DI D + ++++SEDRT KVW L++ L Sbjct: 170 NEHTMSVTDIVIDYGGCNAVIISSSEDRTCKVWSLSRGKL 209 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -3 Query: 329 SGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 SG + W + T + H S+ + F + L++ S+D +++VW L Sbjct: 99 SGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSL 149 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 34.3 bits (75), Expect = 0.025 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = -3 Query: 350 LLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 +L V++ W++ + A A + H G + I F E L TA+ED V++W L + Sbjct: 367 ILGTGTSQSVVKIWDVKSQANVAKFDGHTGEVTAISFSENGYFLATAAED-GVRLWDLRK 425 Query: 170 ASLRSICSF 144 LR+ SF Sbjct: 426 --LRNFKSF 432 Score = 31.9 bits (69), Expect = 0.13 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L H + + F S+ +LTAS D+TV++W+ Sbjct: 260 LTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR 292 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 34.3 bits (75), Expect = 0.025 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = -3 Query: 350 LLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 +L V++ W++ + A A + H G + I F E L TA+ED V++W L + Sbjct: 367 ILGTGTSQSVVKIWDVKSQANVAKFDGHTGEVTAISFSENGYFLATAAED-GVRLWDLRK 425 Query: 170 ASLRSICSF 144 LR+ SF Sbjct: 426 --LRNFKSF 432 Score = 31.9 bits (69), Expect = 0.13 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L H + + F S+ +LTAS D+TV++W+ Sbjct: 260 LTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR 292 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 34.3 bits (75), Expect = 0.025 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 329 SGVLRQWNMLTVAQN-A*LNAHDGSINDIYFDEASNTLL-TASEDRTVKVWK 180 SGV + W + V L H + D+ F + L TAS DRT K+WK Sbjct: 84 SGVPKLWEVPQVTNKIVVLKGHKEHVTDVVFSSVDDECLATASTDRTEKIWK 135 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 33.9 bits (74), Expect = 0.033 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 H G +N + +D + L + S+D T K+W + Q++ Sbjct: 447 HQGEVNCVKWDPTGSLLASCSDDSTAKIWNIKQST 481 Score = 29.1 bits (62), Expect = 0.93 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L+ H G I + +++ + LLT S DRT VW Sbjct: 361 LSKHKGPIFSLKWNKKGDYLLTGSVDRTAVVW 392 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 33.9 bits (74), Expect = 0.033 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRS 156 N H ++ I F+ A + ++T S+D VK+WK + ++S Sbjct: 186 NGHSSTVWSISFNAAGDKMVTCSDDLAVKIWKTDISRMQS 225 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 33.9 bits (74), Expect = 0.033 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L WNM + + L AH+G I + A+ + +AS D+ VK+WK Sbjct: 886 LELWNM-SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK 931 Score = 32.7 bits (71), Expect = 0.075 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 W T+ L H I DI F + L T+S D+TV+VW Sbjct: 678 WYTDTMKPKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRVW 720 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 33.9 bits (74), Expect = 0.033 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVA-QNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 G LL GV+ WN+ Q+ +AHD SI + F L++AS D ++K+W Sbjct: 236 GRPLLASGGSFGVISIWNLNKKRLQSVIRDAHDSSIISLNFLANEPVLMSASADNSLKMW 295 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRS 156 AHDG + + D + +++A +KVW + L+S Sbjct: 472 AHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKS 510 >At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A phosphatases pleiotropic regulator PRL2 {Arabidopsis thaliana}, GB:Q39190 from [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 1 weak) Length = 479 Score = 33.9 bits (74), Expect = 0.033 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLR 159 L H G + + FD ++ T S DRT+K+W + L+ Sbjct: 166 LQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLK 205 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 299 TVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 T+ Q L + G I +D+ + L+T D+T+K+WK Sbjct: 418 TIVQPGSLESEAG-IYAACYDQTGSRLVTCEGDKTIKMWK 456 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 V R W++ T Q L HD + + ++T S D T+K W L Sbjct: 277 VCRVWDIRTKMQIFVL-PHDSDVFSVLARPTDPQVITGSHDSTIKFWDL 324 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 33.9 bits (74), Expect = 0.033 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 G LR W++ T H + + F + +++AS DRT+K+W Sbjct: 85 GELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLW 132 Score = 29.9 bits (64), Expect = 0.53 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 224 TLLTASEDRTVKVWKLTQASLRS 156 T+++AS D+TVKVW L LR+ Sbjct: 165 TIVSASWDKTVKVWNLQNCKLRN 187 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 33.5 bits (73), Expect = 0.043 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 W + + L H I + F ++TAS D+TVK+W ++ S Sbjct: 526 WRLPDLVHVVTLKGHKRRIFSVEFSTVDQCVMTASGDKTVKIWAISDGS 574 Score = 33.1 bits (72), Expect = 0.057 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 AHD IN + + + T SEDRT +W+L Sbjct: 497 AHDKDINSVAVARNDSLVCTGSEDRTASIWRL 528 Score = 32.7 bits (71), Expect = 0.075 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 269 HDGSINDIYF--DEASNTLLTASEDRTVKVWKLTQASLRSIC 150 H G ++ I F D N L++ S+D TV+VW L + C Sbjct: 143 HKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKC 184 Score = 32.3 bits (70), Expect = 0.100 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEAS-NTLLTASEDRTVKVW 183 GN L+ +R WN + + H+G I + F + S + ++ S DRT+KVW Sbjct: 415 GNVLIVTGSKDKTVRLWNATSKSCIGVGTGHNGDILAVAFAKKSFSFFVSGSGDRTLKVW 474 Query: 182 KL 177 L Sbjct: 475 SL 476 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 + LL S +R W++ T+ H+G + + + L TA DR V VW Sbjct: 72 DKLLFSAGHSRQIRVWDLETLKCIRSWKGHEGPVMGMACHASGGLLATAGADRKVLVW 129 >At4g38480.1 68417.m05438 transducin family protein / WD-40 repeat family protein contains contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 3 weak);similar to gene PC326 protein - mouse, PIR2:S37694 Length = 471 Score = 33.5 bits (73), Expect = 0.043 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLR 159 L+ H G +N + F+ + LL+ S+DR V +W AS++ Sbjct: 51 LDKHKGCVNTVSFNADGDILLSGSDDRQVILWDWQTASVK 90 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 33.5 bits (73), Expect = 0.043 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 AH +I DI + + + LLTAS D+T+KVW + + Sbjct: 126 AHYNAIFDISWIKGDSCLLTASGDQTIKVWDVEE 159 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 33.5 bits (73), Expect = 0.043 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 G LR W++ T H + + F + +++AS DRT+K+W Sbjct: 85 GELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLW 132 Score = 29.9 bits (64), Expect = 0.53 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 224 TLLTASEDRTVKVWKLTQASLRS 156 T+++AS D+TVKVW L LR+ Sbjct: 165 TIVSASWDKTVKVWNLQNCKLRN 187 Score = 26.6 bits (56), Expect = 5.0 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = -3 Query: 230 SNTLLTASEDRTVKVWKLTQ 171 S+ ++TAS D+++ +WKLT+ Sbjct: 28 SDIIVTASRDKSIILWKLTK 47 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 33.5 bits (73), Expect = 0.043 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRS 156 N H ++ I F+ A + ++T S+D T+K+W A ++S Sbjct: 210 NGHSSTVWSISFNAAGDKMVTCSDDLTLKIWGTDIAKMQS 249 Score = 31.1 bits (67), Expect = 0.23 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 G++ + I E S + R W TV + H ++ + + L TAS D T +WK Sbjct: 47 GDNTVRIWEQSSLSRSWTCKTVLEET----HTRTVRSCAWSPSGQLLATASFDGTTGIWK 102 Score = 29.5 bits (63), Expect = 0.70 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -3 Query: 272 AHDGSINDIYFD--EASNTLLTASEDRTVKVWKL 177 AH+ +N + + E + L +AS+D VK+W+L Sbjct: 315 AHENDVNSVQWSPGEGNRLLASASDDGMVKIWQL 348 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 33.5 bits (73), Expect = 0.043 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 Q+ ++AH G +NDI F + L T +D+T+KVW Sbjct: 454 QHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVW 491 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 33.5 bits (73), Expect = 0.043 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVW 183 Q+ ++AH G +NDI F + L T +D+T+KVW Sbjct: 454 QHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVW 491 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 33.5 bits (73), Expect = 0.043 Identities = 14/33 (42%), Positives = 24/33 (72%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L H G + D+ + + SN LL+AS+D+TV++W+ Sbjct: 268 LYGHTGDVLDLAWSD-SNLLLSASKDKTVRLWR 299 Score = 32.3 bits (70), Expect = 0.100 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLT 174 +N H G I + F L T ED VK+W++T Sbjct: 194 INGHKGKIWTLKFSPDGKYLATGGEDGVVKIWRIT 228 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 33.5 bits (73), Expect = 0.043 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = -3 Query: 314 QWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 QW++ T + H G++N I F + + +T+S+D++++VW+ Sbjct: 396 QWDINTGEVTQEYDQHLGAVNTITFVDNNRRFVTSSDDKSLRVWE 440 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVW 183 H ++ DI F + LTA D+ +K W Sbjct: 325 HAKAVRDICFSNDGSKFLTAGYDKNIKYW 353 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 33.1 bits (72), Expect = 0.057 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSIC 150 L H ++ FD + ++T S+DR VK+W + A + C Sbjct: 301 LRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETALCLASC 343 Score = 32.7 bits (71), Expect = 0.075 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +++ W+M T A H+G I D+ + + +AS D ++VW+L Sbjct: 328 LVKIWSMETALCLASCRGHEGDITDLAVSSNNALVASASNDFVIRVWRL 376 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.1 bits (72), Expect = 0.057 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 +AHDGSI + F + +A ED V+VW +T+ Sbjct: 215 SAHDGSILAMKFSPDGKYIASAGEDCVVRVWSITE 249 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.1 bits (72), Expect = 0.057 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 +AHDGSI + F + +A ED V+VW +T+ Sbjct: 215 SAHDGSILAMKFSPDGKYIASAGEDCVVRVWSITE 249 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 32.7 bits (71), Expect = 0.075 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +++ W++ +H+G I + F L T S DRTVK W L Sbjct: 166 IVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDL 214 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 H +N + F +++ ED VKVW LT L Sbjct: 142 HTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKL 177 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 L H I+ + FD + + + T+K+W L +A + Sbjct: 55 LYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKI 93 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 32.7 bits (71), Expect = 0.075 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +++ W++ +H+G I + F L T S DRTVK W L Sbjct: 166 IVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDL 214 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 H +N + F +++ ED VKVW LT L Sbjct: 142 HTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKL 177 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 L H I+ + FD + + + T+K+W L +A + Sbjct: 55 LYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKI 93 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDI-YFDEASNT-LLTASEDRTVKVW 183 ++ WN+ + N L+AH +N + YF L+T S+D T KVW Sbjct: 167 IKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVW 214 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSF 144 W+ T + L+ H +++ + F ++T SED TV++W T L + ++ Sbjct: 214 WDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNY 269 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 269 HDGSINDIYFD-EASNTLLTASEDRTVKVWKL 177 H + + F+ + +NT +AS DRT+K+W L Sbjct: 141 HSHYVMQVVFNPKDTNTFASASLDRTIKIWNL 172 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDI-YFDEASNT-LLTASEDRTVKVW 183 ++ WN+ + N L+AH +N + YF L+T S+D T KVW Sbjct: 167 IKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVW 214 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSF 144 W+ T + L+ H +++ + F ++T SED TV++W T L + ++ Sbjct: 214 WDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNY 269 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 269 HDGSINDIYFD-EASNTLLTASEDRTVKVWKL 177 H + + F+ + +NT +AS DRT+K+W L Sbjct: 141 HSHYVMQVVFNPKDTNTFASASLDRTIKIWNL 172 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDI-YFDEASNT-LLTASEDRTVKVW 183 ++ WN+ + N L+AH +N + YF L+T S+D T KVW Sbjct: 167 IKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVW 214 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSF 144 W+ T + L+ H +++ + F ++T SED TV++W T L + ++ Sbjct: 214 WDYQTKSCVQTLDGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNY 269 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 269 HDGSINDIYFD-EASNTLLTASEDRTVKVWKL 177 H + + F+ + +NT +AS DRT+K+W L Sbjct: 141 HSHYVMQVVFNPKDTNTFASASLDRTIKIWNL 172 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 32.7 bits (71), Expect = 0.075 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 + AH+G++ I F + ++ L + DR + VW++ + L S+ Sbjct: 400 IQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSM 441 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDI-YFDEASNT-LLTASEDRTVKVW 183 ++ WN+ + N L+AH +N + YF L+T S+D T KVW Sbjct: 167 IKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVW 214 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSF 144 W+ T + L H +++ + F ++T SED TV++W T L + ++ Sbjct: 214 WDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNY 269 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 269 HDGSINDIYFD-EASNTLLTASEDRTVKVWKL 177 H + + F+ + +NT +AS DRT+K+W L Sbjct: 141 HSHYVMQVTFNPKDTNTFASASLDRTIKIWNL 172 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSFF 141 + AHD ++N + A + + T S D TVKVWK R+ S F Sbjct: 173 IKAHDDAVNSV--TTAESLVFTGSADGTVKVWKREIRGKRTAHSLF 216 Score = 29.1 bits (62), Expect = 0.93 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 H +++ + E L +AS DRTVKVW++ Sbjct: 134 HSDAVSCLSLAEDQGLLYSASWDRTVKVWRI 164 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 32.3 bits (70), Expect = 0.100 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 Q+ + AHDG+I + F L ++ ED V+VWK+ + Sbjct: 213 QSQDIKAHDGAILAMKFSNDGKFLASSGEDGIVRVWKVVE 252 Score = 31.5 bits (68), Expect = 0.17 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 H G + DI + + N LL+AS D+TV++WK+ Sbjct: 327 HTGEVLDISWSK-DNYLLSASMDKTVRLWKV 356 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 32.3 bits (70), Expect = 0.100 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 317 RQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLR 159 ++ + L V Q +AHDGSI + F L +A ED V+VW + + R Sbjct: 242 KELSSLCVGQE--FSAHDGSIVVMKFSHDGKYLASAGEDCVVRVWNIIEDERR 292 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 32.3 bits (70), Expect = 0.100 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVWKLT 174 Q+ ++AH G++ND+ F + L +T +D+ +KVW ++ Sbjct: 444 QHTEIDAHVGAVNDLAFANPNRQLCVITCGDDKLIKVWDVS 484 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 32.3 bits (70), Expect = 0.100 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 L AH+ I + L TAS D+TVK+W L L + Sbjct: 213 LQAHNSHILKCLLSPGNKYLATASSDKTVKIWNLDGFKLEKV 254 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 GN L ++ WN+ L H+ + D F L+TAS D T ++W Sbjct: 228 GNKYLATASSDKTVKIWNLDGFKLEKVLTGHERWVWDCDFSMDGEYLVTASSDTTARLWS 287 Query: 179 L 177 + Sbjct: 288 M 288 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 31.9 bits (69), Expect = 0.13 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +++ W+M T A H+G I D+ + + +AS D ++VW+L Sbjct: 268 LVKVWSMDTAYCLASCRGHEGDITDLAVSSNNIFIASASNDCVIRVWRL 316 Score = 31.1 bits (67), Expect = 0.23 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSIC 150 L H ++ D + ++T S+DR VKVW + A + C Sbjct: 241 LRGHRNAVYCAILDRSGRYVITGSDDRLVKVWSMDTAYCLASC 283 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 31.9 bits (69), Expect = 0.13 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 272 AHDGSINDIYF-DEASNTLLTASEDRTVKVW 183 AH +N + F DE+ N +L+ S+D KVW Sbjct: 269 AHTSDVNTVCFADESGNLILSGSDDNLCKVW 299 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 31.9 bits (69), Expect = 0.13 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 224 TLLTASEDRTVKVWKLTQASLRS 156 T+++AS D+TVKVW L+ LRS Sbjct: 166 TIVSASWDKTVKVWNLSNCKLRS 188 Score = 31.5 bits (68), Expect = 0.17 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 G LR W++ H + + F + +++AS DRT+K+W Sbjct: 85 GELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIKLW 132 >At1g15850.1 68414.m01902 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); mRNA-associated protein mrnp 41 (SP:P78406) [Homo sapiens]; similar to mitotic checkpoint protein GI:9294423 from [Arabidopsis thaliana] Length = 140 Score = 31.9 bits (69), Expect = 0.13 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 317 RQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVK 189 + W +L+ AQ + + HD N I + N L+T S D+T+K Sbjct: 98 KMWPLLSGAQPSTVAMHDAPFNQIAWIPGMNLLVTGSWDKTLK 140 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 V++ W++ H+G I + F L T S DRTVK W L Sbjct: 114 VVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDL 162 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/53 (28%), Positives = 20/53 (37%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 LR W+ H I+ I F +++ D VKVW LT L Sbjct: 73 LRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKL 125 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 31.5 bits (68), Expect = 0.17 Identities = 13/64 (20%), Positives = 31/64 (48%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +SL+ + G +R W+ N+H G++ + +++ + L + S+D + +W + Sbjct: 76 SSLVAVGYADGSIRIWDTEKGTCEVNFNSHKGAVTALRYNKVGSMLASGSKDNDIILWDV 135 Query: 176 TQAS 165 S Sbjct: 136 VGES 139 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 31.5 bits (68), Expect = 0.17 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTL--LTASEDRTVKVWKLTQASL 162 Q+ ++AH G +ND+ F + + +T +D+ +KVW L+ L Sbjct: 445 QHLEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIKVWDLSGKKL 489 >At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 825 Score = 31.1 bits (67), Expect = 0.23 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 + AH GSI I F L +A ED +++WK+ ++ Sbjct: 359 IQAHKGSIWSIKFSLDGRYLASAGEDCVIQIWKVVES 395 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 31.1 bits (67), Expect = 0.23 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 V++ W++ +H+G I + F L T S D+TVK W L Sbjct: 259 VVKVWDLTAGKLLHEFKSHEGKIQSLDFHPHEFLLATGSADKTVKFWDL 307 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 H +N + F +++ ED VKVW LT L Sbjct: 235 HTRGVNVLRFTPDGRWIVSGGEDNVVKVWDLTAGKL 270 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 L H I+ + FD + + + T+K+W L +A + Sbjct: 148 LYGHSSGIDSVTFDASEGLVAAGAASGTIKLWDLEEAKV 186 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 31.1 bits (67), Expect = 0.23 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 + AH G I + F S+ L +A ED + VW++ + + S+ Sbjct: 407 IQAHQGGIWTMKFSPDSHLLASAGEDCAIHVWEVQECEIMSM 448 >At4g35140.1 68417.m04996 transducin family protein / WD-40 repeat family protein contains 6 (3 significant) WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus]; Human (H326) mRNA, Homo sapiens, gb:U06631 Length = 496 Score = 31.1 bits (67), Expect = 0.23 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H G +N + F+ + L++ S+DR V +W Sbjct: 55 LEKHKGCVNTVSFNAEGDVLISGSDDRRVVLW 86 >At4g29380.1 68417.m04197 protein kinase family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00069: Protein kinase domain; contains PF02985: HEAT repeat; similar to adaptor protein (GI:1817584) [Homo sapiens]; similar to VPS15 protein (GI:6103009) [Pichia pastoris] Length = 1494 Score = 31.1 bits (67), Expect = 0.23 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H ++NDI + ++AS+D TVKVW Sbjct: 1077 LQEHRSAVNDIATSSDHSFFVSASDDSTVKVW 1108 >At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat family protein similar to C. elegans putative WD-repeat protein C14B1.4 (SP:Q17963) Length = 333 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 L H +I+ + F N L +AS D+T+ +W T SL Sbjct: 39 LEGHTAAISCVKFSNDGNLLASASVDKTMILWSATNYSL 77 Score = 29.9 bits (64), Expect = 0.53 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 +R W + T + AH I+ ++F+ + +++AS D + K+W Sbjct: 152 IRIWEVKTGKCVRMIKAHSMPISSVHFNRDGSLIVSASHDGSCKIW 197 Score = 26.2 bits (55), Expect = 6.6 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVW 183 H I+D+ + S+ +AS+D T+++W Sbjct: 84 HSSGISDLAWSSDSHYTCSASDDCTLRIW 112 >At1g80670.1 68414.m09466 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400) (1 weak); similar to Hypothetical RAE1-like protein.(SP:Q38942) [Arabidopsis thaliana]; similar to mRNA-associated protein mrnp 41 ((mRNA export protein) (GB:AAC28126) (GI:1903456)(RAE1) (MRNP41) (SP:P78406) [Homo sapiens] Length = 349 Score = 31.1 bits (67), Expect = 0.23 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 317 RQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 + W +L+ Q + H+G I + + N L T S D+T+K W Q Sbjct: 97 KMWPLLSGGQPVTVAMHEGPIAAMAWIPGMNLLATGSWDKTLKYWDTRQ 145 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 31.1 bits (67), Expect = 0.23 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDI-YFDEASNT-LLTASEDRTVKVW 183 ++ WN+ + N L+AH +N + YF L+T S+D T KVW Sbjct: 167 IKIWNLGSPDPNFTLDAHLKGVNCVDYFTGGDKPYLITGSDDHTAKVW 214 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICSF 144 W+ T + L H +++ + F ++T SED TV++W T L + ++ Sbjct: 214 WDYQTKSCVQTLEGHTHNVSAVSFHPELPIIITGSEDGTVRIWHATTYRLENTLNY 269 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 269 HDGSINDIYFD-EASNTLLTASEDRTVKVWKL 177 H + + F+ + +NT +AS DRT+K+W L Sbjct: 141 HSHYVMQVTFNPKDTNTFASASLDRTIKIWNL 172 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 31.1 bits (67), Expect = 0.23 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 323 VLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 V++ W++ H+G I + F L T S DRTVK W L Sbjct: 165 VVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFWDL 213 Score = 27.1 bits (57), Expect = 3.8 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 L H +++ + FD A +L + +K+W + +A + Sbjct: 54 LCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKM 92 Score = 27.1 bits (57), Expect = 3.8 Identities = 12/58 (20%), Positives = 24/58 (41%) Frame = -3 Query: 350 LLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L+ SGV++ W++ H + + + F L + S D +K+W + Sbjct: 72 LVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDANLKIWDI 129 >At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Myosin heavy chain kinase B (MHCK B).(SP:P90648) [Dictyostelium discoideum] Length = 495 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 ++AHD +IN + + + T S D TVKVWK Sbjct: 273 IHAHDDAINSV-MSGFDDLVFTGSADGTVKVWK 304 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 290 QNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS-LRSI 153 +N+ H+ +++ + D L ++S D T+KVW++ + L SI Sbjct: 227 RNSVKTKHNDAVSSLSLDVELGLLYSSSWDTTIKVWRIADSKCLESI 273 >At3g18860.2 68416.m02396 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 30.7 bits (66), Expect = 0.30 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICS 147 L+ HD + I N + T+S DRT++VW L + R S Sbjct: 16 LHGHDDDVRGICVCNDEN-IATSSRDRTIRVWSLDPSDKRKYTS 58 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 233 ASNTLLTASEDRTVKVWK 180 +S +++ASEDR K+WK Sbjct: 240 SSGLIVSASEDRHAKIWK 257 >At3g18860.1 68416.m02395 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 30.7 bits (66), Expect = 0.30 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICS 147 L+ HD + I N + T+S DRT++VW L + R S Sbjct: 16 LHGHDDDVRGICVCNDEN-IATSSRDRTIRVWSLDPSDKRKYTS 58 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 233 ASNTLLTASEDRTVKVWK 180 +S +++ASEDR K+WK Sbjct: 240 SSGLIVSASEDRHAKIWK 257 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 30.7 bits (66), Expect = 0.30 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 + H GSI + + S +LT S D++ KVW++ + Sbjct: 93 DGHKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAE 127 >At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 523 Score = 30.7 bits (66), Expect = 0.30 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H + I F ++ +LTAS D+TV++W Sbjct: 260 LTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW 291 Score = 30.7 bits (66), Expect = 0.30 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -3 Query: 350 LLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +L +++ W++ + A A H+G I I F E L TA+ D V++W L Sbjct: 368 ILGTGTAQSIVKIWDVKSQANVAKFGGHNGEITSISFSENGYFLATAALD-GVRLWDL 424 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 30.3 bits (65), Expect = 0.40 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 G + W++ T L H+ + + + + L + S D TVK+W +T ++ Sbjct: 563 GTIMMWDLSTARCITPLMGHNSCVWSLSYSGEGSLLASGSADCTVKLWDVTSST 616 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSIC 150 L H G + F + +L++S D T+++W T+ + +C Sbjct: 414 LLGHSGPVYSATFSPPGDFVLSSSADTTIRLWS-TKLNANLVC 455 Score = 26.2 bits (55), Expect = 6.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 263 GSINDIYFDEASNTLLTASEDRTVKVW 183 G ++D+ + N + T S D+TV++W Sbjct: 500 GHLSDVDWHPNCNYIATGSSDKTVRLW 526 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +R W+ A H+ + D F + + S DRT ++W + Sbjct: 442 IRLWSTKLNANLVCYKGHNYPVWDAQFSPFGHYFASCSHDRTARIWSM 489 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/59 (23%), Positives = 27/59 (45%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 +S+L + WNM T L H + + +D + + + S+D+TV +W+ Sbjct: 130 DSMLASGSLDNTVHIWNMRTGMCTTVLRGHLSLVKGVTWDPIGSFIASQSDDKTVIIWR 188 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 30.3 bits (65), Expect = 0.40 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 L HD ++ + + A+ ++T S D+TVK W AS Sbjct: 94 LGTHDKAVRCVEYSYAAGQVITGSWDKTVKCWDPRGAS 131 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 30.3 bits (65), Expect = 0.40 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 + AH+GSI I F L +A ED + +W++ +A Sbjct: 409 IQAHNGSIWSIKFSLDGKYLASAGEDCIIHIWQVVEA 445 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 L HD ++ I + SN ++T S DR VW L A Sbjct: 51 LQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGA 87 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 L HD ++ I + SN ++T S DR VW L A Sbjct: 51 LQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGA 87 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 L HD ++ I + SN ++T S DR VW L A Sbjct: 51 LQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGA 87 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 30.3 bits (65), Expect = 0.40 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 332 GSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLL-TASEDRTVKVW 183 G LR W++ + AHD I +++ + +L T+S D+TVKVW Sbjct: 170 GDCTLRIWDVREPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVW 220 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 29.9 bits (64), Expect = 0.53 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSICS 147 G +++W + +++ + +AH+ +NDI S+T AS D T+ VW L S+ S Sbjct: 259 GSVQKWELASLSCVSSYHAHEEVVNDIGI--LSSTGKVASCDGTIHVWNSQTGKLISLFS 316 Score = 29.1 bits (62), Expect = 0.93 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 AHDG + + E S+ L+++S D+T+++W L ++ Sbjct: 452 AHDGYVTKLVAPE-SHLLVSSSLDKTLRIWDLRKS 485 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 29.9 bits (64), Expect = 0.53 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L+ H + I S+ L TAS+D TV++W Sbjct: 140 LDGHQKVVTGIALPSGSDKLYTASKDETVRIW 171 >At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1218 Score = 29.9 bits (64), Expect = 0.53 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = -3 Query: 329 SGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 SGV++ W+ + H+G + ++F + ++ +D +KVW Sbjct: 30 SGVIQLWDYRMGTLIDRFDEHEGPVRGVHFHNSQPLFVSGGDDYKIKVW 78 Score = 29.5 bits (63), Expect = 0.70 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 L H +++ + F + +++ SED++++VW T+ Sbjct: 244 LRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVWDATK 279 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 L HD +N F +++ ++DR VK+W++ + Sbjct: 200 LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNE 235 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 ++ WN T L H I + F + +++AS+D+T+++W Sbjct: 75 IKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW 120 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +R WN + + L H+ + F + +++AS D+TV+VW + Sbjct: 117 IRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI 164 >At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1216 Score = 29.9 bits (64), Expect = 0.53 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = -3 Query: 329 SGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 SGV++ W+ + H+G + ++F + ++ +D +KVW Sbjct: 30 SGVIQLWDYRMGTLIDRFDEHEGPVRGVHFHNSQPLFVSGGDDYKIKVW 78 Score = 29.5 bits (63), Expect = 0.70 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 L H +++ + F + +++ SED++++VW T+ Sbjct: 244 LRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVWDATK 279 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 L HD +N F +++ ++DR VK+W++ + Sbjct: 200 LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNE 235 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 320 LRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 +R WN + + L H+ + F + +++AS D+TV+VW + Sbjct: 117 IRIWNWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI 164 >At1g24530.1 68414.m03088 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 7 WD-40 repeats (PF00400) Length = 418 Score = 29.9 bits (64), Expect = 0.53 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L HD +I ++ S+ LL+ S DRTV++W+ Sbjct: 322 LRGHDKAILSLF--NVSDLLLSGSADRTVRIWR 352 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 L H ++N + ++ + L + S DR++ VW+ S Sbjct: 276 LEKHKSAVNALALNDDGSVLFSGSCDRSILVWEREDTS 313 >At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat family protein SOF1 (involved in rRNA processing) protein-yeast Length = 442 Score = 29.5 bits (63), Expect = 0.70 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 G +R W++ + H G++ + N L++ D TV++W + + SL Sbjct: 79 GDIRLWDISSRRTVCQFPGHQGAVRGLTASTDGNVLVSCGTDCTVRLWNVPRPSL 133 >At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.5 bits (63), Expect = 0.70 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L H+GSI I + + +++ S+DR+ ++W++ Sbjct: 231 LTGHEGSIFRIVWSLDGSKIVSVSDDRSARIWEI 264 >At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.5 bits (63), Expect = 0.70 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L H+GSI I + + +++ S+DR+ ++W++ Sbjct: 231 LTGHEGSIFRIVWSLDGSKIVSVSDDRSARIWEI 264 >At3g06880.1 68416.m00817 transducin family protein / WD-40 repeat family protein similar to PAK/PLC-interacting protein 1 (GI:4211689) {Homo sapiens} Length = 1115 Score = 29.5 bits (63), Expect = 0.70 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -3 Query: 350 LLXIXEGSGVLRQWNMLTVAQNA*--LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 LL G +R WN+ + H ++ E +L+ S D+T++VW++ Sbjct: 865 LLFSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGECVLSGSADKTIRVWQI 924 Query: 176 TQASL 162 + L Sbjct: 925 VKGKL 929 >At2g16405.1 68415.m01878 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD-repeat protein 13 (SP:Q9H1Z4) [Homo sapiens] Length = 482 Score = 29.5 bits (63), Expect = 0.70 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 L H + D F + + ++S D+T++VW+L++ Sbjct: 212 LTGHSKDVTDFDFSSNNQYIASSSLDKTIRVWELSR 247 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 29.5 bits (63), Expect = 0.70 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVW 183 H +N F + ++TAS D TVKVW Sbjct: 346 HTSYVNHAIFTSDGSRIITASSDCTVKVW 374 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 HD + I F S L + S+D +K+W++ Sbjct: 262 HDDPVLCIDFSRDSEMLASGSQDGKIKIWRI 292 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/65 (21%), Positives = 27/65 (41%) Frame = -3 Query: 356 NSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 + +L G ++ W + T +AH + + F + LL+ S D+T ++ L Sbjct: 275 SEMLASGSQDGKIKIWRIRTGVCIRRFDAHSQGVTSLSFSRDGSQLLSTSFDQTARIHGL 334 Query: 176 TQASL 162 L Sbjct: 335 KSGKL 339 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWK 180 H+ + I N L T SED T+K+WK Sbjct: 481 HEKDVIGITHHPHRNLLATYSEDCTMKLWK 510 >At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 29.5 bits (63), Expect = 0.70 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTA-SEDRTVKVWKLTQ 171 GV++ W++ + H+ + I + A TLL + S+D +VK+W + Q Sbjct: 556 GVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQ 608 >At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 29.5 bits (63), Expect = 0.70 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTA-SEDRTVKVWKLTQ 171 GV++ W++ + H+ + I + A TLL + S+D +VK+W + Q Sbjct: 556 GVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQ 608 >At5g10940.1 68418.m01269 transducin family protein / WD-40 repeat family protein unnamed ORF cDNA FLJ10872, Homo sapiens, EMBL:AK001734; contains Pfam PF00400: WD domain, G-beta repeat (6 copies,1 weak) Length = 757 Score = 29.1 bits (62), Expect = 0.93 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = -3 Query: 296 VAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 ++Q L H G +N + ++ + L++ S+D + +W + L Sbjct: 40 LSQEQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWNYSSRKL 84 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 29.1 bits (62), Expect = 0.93 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L H ++ + F S ++TAS+D +++VW + Sbjct: 285 LKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNI 318 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.1 bits (62), Expect = 0.93 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H +I D+++ + +++AS D+TV+ W Sbjct: 92 LKGHKNAILDLHWTSDGSQIVSASPDKTVRAW 123 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 29.1 bits (62), Expect = 0.93 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS-LRSI 153 H +++ + ++ L +AS DRT+KVW++ + L SI Sbjct: 205 HADAVSCLSLNDEQGLLYSASWDRTIKVWRIADSKCLESI 244 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 AHD ++N + + + S D TVK WK Q Sbjct: 246 AHDDAVNSVV-STTEAIVFSGSADGTVKAWKRDQ 278 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 29.1 bits (62), Expect = 0.93 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 W++ + Q L H I I E +TL+T S+D T +VW +++ S ++ Sbjct: 1007 WDIRSGKQMHKLKGHTKWIRSIRMVE--DTLITGSDDWTARVWSVSRGSCDAV 1057 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/55 (18%), Positives = 26/55 (47%) Frame = -3 Query: 317 RQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASLRSI 153 R W++ + +A L H G + + + ++T S D ++ W+ + ++ + Sbjct: 1045 RVWSVSRGSCDAVLACHAGPVQSVEYSPFDKGIITGSADGLLRFWENDEGGIKCV 1099 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 W+ T L HD ++ + + +LTA+ D TVK+W Sbjct: 924 WDKQTTQLLEELKGHDSQVSCVKM-LSGERVLTAAHDGTVKMW 965 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H +N +YF + +AS D++V++W Sbjct: 356 LTGHQQLVNHVYFSPDGKWIASASFDKSVRLW 387 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 G R W++ L+ H ++ + + + T S+D T+K+W+ TQ L Sbjct: 221 GDARIWDITLKKSIICLSGHTLAVTCVKWG-GDGIIYTGSQDCTIKMWETTQGKL 274 >At1g52730.2 68414.m05959 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 H G ++ + F + + SED T+++W+ T A+ Sbjct: 269 HHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPAN 303 >At1g52730.1 68414.m05958 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 H G ++ + F + + SED T+++W+ T A+ Sbjct: 269 HHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPAN 303 >At1g51690.2 68414.m05825 serine/threonine protein phosphatase 2A (PP2A) 55 kDa regulatory subunit B identical to 55 kDa B regulatory subunit of phosphatase 2A (GI:710330) [Arabidopsis thaliana]; similar to type 2A protein serine/threonine phosphatase 55 kDa B regulatory GI:1408460 [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (5 copies, 3 weak) Length = 512 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -3 Query: 257 INDIYFDEASN--TLLTASEDRTVKVWKLTQASLRSIC 150 IN I + + +N L ++ D+T+K WK+ ++ IC Sbjct: 117 INKIRWCQTANGALFLLSTNDKTIKFWKVQDKKIKKIC 154 >At1g51690.1 68414.m05824 serine/threonine protein phosphatase 2A (PP2A) 55 kDa regulatory subunit B identical to 55 kDa B regulatory subunit of phosphatase 2A (GI:710330) [Arabidopsis thaliana]; similar to type 2A protein serine/threonine phosphatase 55 kDa B regulatory GI:1408460 [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (5 copies, 3 weak) Length = 513 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -3 Query: 257 INDIYFDEASN--TLLTASEDRTVKVWKLTQASLRSIC 150 IN I + + +N L ++ D+T+K WK+ ++ IC Sbjct: 117 INKIRWCQTANGALFLLSTNDKTIKFWKVQDKKIKKIC 154 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/44 (25%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLL-TASEDRTVKVW 183 WN+ L+ H ++N + ++ + +L +AS+D+T+++W Sbjct: 470 WNLKNTKPLEVLSGHSMTVNCVSWNPKNPRMLASASDDQTIRIW 513 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L AH + + F + L TAS D T +WK+ Sbjct: 220 LVAHKNEVWFVQFSNSGKYLATASSDCTAIIWKV 253 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 + AH+G+I + F L +A ED ++VW + + Sbjct: 247 IQAHEGAILAMKFSPDGRYLASAGEDGVLRVWSVVE 282 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 + AH+G+I + F L +A ED ++VW + + Sbjct: 247 IQAHEGAILAMKFSPDGRYLASAGEDGVLRVWSVVE 282 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 L H + N + + + +ASED TV +WKL Sbjct: 346 LKYHRATCNAVSYSPDCELMASASEDATVALWKL 379 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 L+ H+ +++ F + + TL+TAS D T+K+W L + + Sbjct: 878 LSGHNKAVSYAKFLD-NETLVTASTDNTLKLWDLKKTT 914 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 269 HDGSINDIYFDEASNT-LLTASEDRTVKVWK 180 HDG + D+ + T L+++S D TVK+W+ Sbjct: 339 HDGEVTDLSMCQWMTTRLVSSSVDGTVKIWQ 369 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQ 171 AH I + F LL+ S D ++KVW L Q Sbjct: 371 AHTDDITSVKFSSDGRILLSRSFDGSLKVWDLRQ 404 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKL 177 W++ T H +++ + F ++ L + S DRTVKVW + Sbjct: 249 WDVRTREHVQAFPGHRNTVSCLCFRYGTSELYSGSFDRTVKVWNV 293 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -3 Query: 275 NAHDGSINDIYFDEASNTLLTASEDRTVKVWKLT 174 + H GSI + + +LT S D++ K+W ++ Sbjct: 229 DGHKGSIYAVSWSPDGKQVLTVSADKSAKIWDIS 262 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 269 HDGSINDIYFDEASNT-LLTASEDRTVKVWK 180 HDG + D+ + T L+++S D T+K+W+ Sbjct: 320 HDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQ 350 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 269 HDGSINDIYFDEASNT-LLTASEDRTVKVWK 180 HDG + D+ + T L+++S D T+K+W+ Sbjct: 355 HDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQ 385 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 27.9 bits (59), Expect = 2.1 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 GN L G L W+ T H +N + + S L T ++D VKVW Sbjct: 318 GNWLTFGCAKLGQLLVWDWRTETYILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWN 377 Query: 179 L 177 + Sbjct: 378 V 378 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 27.9 bits (59), Expect = 2.1 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 GN L G L W+ T H +N + + S L T ++D VKVW Sbjct: 358 GNWLTFGCAKLGQLLVWDWRTETYILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWN 417 Query: 179 L 177 + Sbjct: 418 V 418 >At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 protein (ZFWD4) contains 6 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd4 protein (GI:12057170) [Arabidopsis thaliana] Length = 419 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/69 (20%), Positives = 32/69 (46%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 G +L ++ W++ T+ L H G++ + + L+++S D T+KVW Sbjct: 267 GGQMLYSGSVDKTIKMWDLNTLQCIMTLKQHTGTVTSLLCWD--KCLISSSLDGTIKVWA 324 Query: 179 LTQASLRSI 153 ++ + + Sbjct: 325 YSENGILKV 333 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 27.5 bits (58), Expect = 2.8 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYF----DEASNTLLTASEDRTVKVWKLTQA 168 G+ R W+ + L H G+I+ + D + T+ TAS+DRT++++K A Sbjct: 131 GLGRVWSSAGSCSHI-LEGHSGAISSVALVNSNDAETVTVATASKDRTLRLFKFDPA 186 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 27.5 bits (58), Expect = 2.8 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = -3 Query: 326 GVLRQWNMLTVAQNA*LNAHDGSINDIYF----DEASNTLLTASEDRTVKVWKLTQA 168 G+ R W+ + L H G+I+ + D + T+ TAS+DRT++++K A Sbjct: 131 GLGRVWSSAGSCSHI-LEGHSGAISSVALVNSNDAETVTVATASKDRTLRLFKFDPA 186 >At3g50390.1 68416.m05512 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to myosin heavy chain kinase B (gb:U90946) [Dictyostelium discoideum] Length = 469 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 +NAH+ ++N + + T S D TVKVW+ Sbjct: 249 VNAHEDAVNAVV-SGFDGLVFTGSADGTVKVWR 280 >At2g46560.1 68415.m05808 transducin family protein / WD-40 repeat family protein similar to CPY (GI:3096961) {Chironomus thummi}; contains Pfam PF00400: WD domain, G-beta repeat (8 copies, 3 weak)|9780477|gb|BE522499.1|BE522499 Length = 2471 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 272 AHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQASL 162 AH GS+ I ++ LT S+D VK+W A L Sbjct: 2373 AHLGSVTKIATIPRTSLFLTGSKDGEVKLWDAKAAKL 2409 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS 165 L H+ + + + A+ ++T S D+T+K W AS Sbjct: 93 LGTHEKPVRCVEYSYAAGQVITGSWDKTIKCWDPRGAS 130 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 27.1 bits (57), Expect = 3.8 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQW--NMLT--VAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTV 192 G LL G + W N T +A L H ++ +Y +N L + S D+T+ Sbjct: 239 GTDLLFAGTQDGSILAWRYNAATNCFEPSASLTGHTLAVVTLYV--GANRLYSGSMDKTI 296 Query: 191 KVWKL 177 KVW L Sbjct: 297 KVWSL 301 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 311 WNMLTVAQNA*LNAHDGSINDIYFDEAS-NTLLTASEDRTVKVWKL 177 W+ T L H G++N + + + + L +AS+D T+++W L Sbjct: 516 WHRSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGL 561 >At3g20740.1 68416.m02624 fertilization-independent endosperm protein (FIE) contains 6 WD-40 repeats (PF00400); identical to fertilization-independent endosperm protein (GI:4567095) [Arabidopsis thaliana] Length = 369 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -3 Query: 359 GNSLLXIXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTL-LTASEDRTVKVW 183 GN + G++R ++ + + L H S+N+I L +TAS+D +V++W Sbjct: 97 GNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLW 156 Query: 182 KL 177 + Sbjct: 157 NV 158 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -3 Query: 293 AQNA*LNAHDGSINDIYFD-EASNTLLTASEDRTVKVW 183 A++ L H S++ + +D + S+ + TAS D++V++W Sbjct: 57 AKDLELKGHTDSVDQLCWDPKHSDLVATASGDKSVRLW 94 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS-LRSI 153 H +++ + +E L + S D+T+KVW+L+ + L SI Sbjct: 248 HYDAVSCLSLNEELGLLYSGSWDKTLKVWRLSDSKCLESI 287 >At1g64350.1 68414.m07292 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to nuclear pore protein SEH1 (SP:P53011) [Saccharomyces cerevisiae] Length = 326 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 302 LTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWK 180 L V + + L+ H G + + +D + TL + D VK+W+ Sbjct: 268 LPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLWQ 308 >At5g26270.1 68418.m03135 expressed protein ; expression supported by MPSS Length = 305 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 181 FHTLTVLSSLAVNNVFEASSK*ISFIDPSCAFSYAFC 291 F + V S + ++ VF+ SS+ + + + +SY FC Sbjct: 230 FDAVLVTSCVTLDTVFQESSQIVLIVRFALCYSYDFC 266 >At4g21080.1 68417.m03048 Dof-type zinc finger domain-containing protein prolamin box binding factor, Zea mays, PATCHX:G2393775 Length = 249 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 299 TVAQNA*LNAHDGSINDIYFDEASNTLL 216 TV N L HDGS Y+D S+ LL Sbjct: 149 TVRPNHRLAFHDGSFEQDYYDVGSDNLL 176 >At3g15610.1 68416.m01980 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to serine/threonine kinase receptor associated protein GB:NP_035629 (SP:Q9Z1Z2) [Mus musculus]; UNR-interacting protein GB:NP_009109 [Homo sapiens] Length = 341 Score = 26.2 bits (55), Expect = 6.6 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWK 180 H G ++ + F + + SED T+++W+ Sbjct: 269 HHGPVHCVRFAPTGESYASGSEDGTIRIWQ 298 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKVWKLTQAS-LRSI 153 H +++ + +E L + S D+T+KVW+L+ + L SI Sbjct: 244 HFDAVSCLSLNEDLGLLYSGSWDKTLKVWRLSDSKCLESI 283 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 278 LNAHDGSINDIYFDEASNTLLTASEDRTVKVW 183 L H S+N F+ L T+ DR + VW Sbjct: 395 LRGHYESVNTCCFNSNDQELYTSGSDRQILVW 426 >At5g60070.1 68418.m07532 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 548 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 312 MEHAHCSTERVAECTRRINKRYLFR*GLEHIVNS 211 +EHA + +RV +RINK ++ GL++ +NS Sbjct: 338 LEHARETRKRVQGIAKRINKMHVE--GLDNAINS 369 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 269 HDGSINDIYFDEASNTLLTASEDRTVKV 186 H +I+D+ D + TAS D T+K+ Sbjct: 10 HSDTIHDVVMDYYGKRVATASSDCTIKI 37 >At1g74770.1 68414.m08663 expressed protein Length = 985 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 267 VCIQLRVLCYSEHVPLSEH 323 +C+ LR +C S H LSEH Sbjct: 737 LCLSLREICKSMHKLLSEH 755 >At1g61680.1 68414.m06957 terpene synthase/cyclase family protein similar to 1,8-cineole synthase [GI:3309117][Salvia officinalis]; contains Pfam profile: PF01397 terpene synthase family Length = 569 Score = 25.8 bits (54), Expect = 8.7 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -3 Query: 341 IXEGSGVLRQWNMLTVAQNA*LNAHDGSINDIYFDEASNTLLTASEDRTVKVWKLTQA 168 + + +LR W+ L A++ + DGS + Y +E + T E RT K+++A Sbjct: 464 VSSAATILRLWDDLGSAKDENQDGTDGSYVECYLNEYKGS--TVDEARTHVAQKISRA 519 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,835,457 Number of Sequences: 28952 Number of extensions: 91671 Number of successful extensions: 557 Number of sequences better than 10.0: 139 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -