BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0142 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 25 2.0 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 8.2 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 25.0 bits (52), Expect = 2.0 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +1 Query: 4 KNTTRRKSPKIKTAATTVRYQNAKRR----NKNVRS--LK-VKKNPILS 129 +NT R + K TT+R A RR ++N+RS LK +K NP LS Sbjct: 32 RNTVWRVIKRYKEILTTIRKPQANRRSGTVDQNLRSKILKTIKGNPNLS 80 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 474 RIIRSRENAAARCVCVIIKFSTVCLV 397 R++R+ + + VCVI +CL+ Sbjct: 792 RVVRAYKTISHVAVCVIASMVPICLI 817 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,712 Number of Sequences: 2352 Number of extensions: 10134 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -