BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0140 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.5 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.3 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 7.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 603 FLAQSNVPTNSPSRHVILVKIYHVIF 680 FL + TNS HV L +YH+ F Sbjct: 322 FLNITGDKTNSVFEHVKLGSLYHISF 347 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 477 ANLRLGVKHNVTRPPRAPCEQ 539 A++ L +KH V P ++P E+ Sbjct: 91 ADVLLSLKHAVVHPGQSPAEK 111 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 62 SAGFHVAAFICD 27 +AGFH AF C+ Sbjct: 12 AAGFHFGAFTCE 23 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +3 Query: 189 PESIEEVRQNAIDDDLALVWHDSQTIREENP 281 P+S+ N D L W+ + + +NP Sbjct: 367 PDSVYSFINNLTDRKLLSAWYMNTVLGHQNP 397 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +3 Query: 189 PESIEEVRQNAIDDDLALVWHDSQTIREENP 281 P+S+ N D L W+ + + +NP Sbjct: 259 PDSVYSFINNLTDRKLLSAWYMNTVLGHQNP 289 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/23 (30%), Positives = 16/23 (69%) Frame = -3 Query: 304 VSTSPAPTGFSSRIV*ESCQTRA 236 ++ + AP G +++V +SC+ +A Sbjct: 120 MANTAAPNGHQTQVVYDSCKLQA 142 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,478 Number of Sequences: 336 Number of extensions: 2987 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -