BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0140 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 3.0 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 7.0 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 7.0 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 80 DFLRNRDTGSGARRVTGDQL 139 DF+ GSGAR + GD++ Sbjct: 147 DFIEREYLGSGARFIAGDEI 166 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 23.4 bits (48), Expect = 7.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 276 NPVGAGDVDTGQYAASAAGCATHAPQPPHTCI 371 NP +V Y+ AAG T A Q HTC+ Sbjct: 54 NPFTDIEVTHNIYSMIAAGNDTTALQVTHTCL 85 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 7.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 301 STSPAPTGFSSRIV*ESCQTRARSSSMAFCLTSSIDSGS 185 +T+P P G S +I+ T S++ A L +S+D+ S Sbjct: 167 TTTPNPVGESDQILEIQASTTPVSATTANSLGTSLDAQS 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,628 Number of Sequences: 2352 Number of extensions: 12535 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -