BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0138 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.59 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 9.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.4 bits (53), Expect = 0.59 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +1 Query: 55 NGGSCSTESTNCICPPGYTGSYCETRIASYLMSPPPPVNPCSLHPCRNGGTCKPDRNSWM 234 + S +++S + PP S SYL ++PC+ C G C+ NS + Sbjct: 44 DASSSNSDSLSMTIPPSIDRSSIHEE--SYLAESSRSIDPCASKYCGIGKECELSPNSTI 101 Query: 235 NHTCDC 252 C C Sbjct: 102 -AVCVC 106 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 49 CENGGSCSTESTNCICPPGY 108 C+ G S C C PGY Sbjct: 234 CKGDGKWYLPSGGCHCKPGY 253 Score = 22.2 bits (45), Expect = 5.5 Identities = 14/48 (29%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 34 SESCQCENGGSCSTES--TNCICPPGYTGSYCETRIASYLMSPPPPVN 171 S SC+ S S++ T C C PGY + + + P P N Sbjct: 276 SHSCEACPAHSKSSDYGFTECRCDPGYFRAEKDPKKMPCTQPPSAPQN 323 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 718 NIHGYPGFIGCI 753 N+HG PG +G I Sbjct: 333 NLHGMPGILGGI 344 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +3 Query: 78 IHQLHMPTRLYGIVLRDAHRILPDVATSA 164 +H L +++G R HR+ V S+ Sbjct: 195 VHSLEFSDQIHGYRCRTMHRLTRQVVVSS 223 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +3 Query: 78 IHQLHMPTRLYGIVLRDAHRILPDVATSA 164 +H L +++G R HR+ V S+ Sbjct: 195 VHSLEFSDQIHGYRCRTMHRLTRQVVVSS 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.137 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,221 Number of Sequences: 438 Number of extensions: 5517 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -