BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0136 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40413| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 8e-26 SB_40412| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 6e-22 SB_18673| Best HMM Match : CH (HMM E-Value=2.5e-05) 84 1e-16 SB_7905| Best HMM Match : CH (HMM E-Value=1.3e-10) 75 5e-14 SB_39070| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_20280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18675| Best HMM Match : NUMOD3 (HMM E-Value=8) 49 5e-06 SB_36121| Best HMM Match : CH (HMM E-Value=0.0017) 45 6e-05 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_28994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53975| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) 39 0.005 SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) 36 0.047 SB_47687| Best HMM Match : SCP (HMM E-Value=1.8e-16) 33 0.25 SB_7838| Best HMM Match : Filamin (HMM E-Value=1.1e-22) 33 0.33 SB_15403| Best HMM Match : CH (HMM E-Value=0) 33 0.33 SB_2620| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_56324| Best HMM Match : ASC (HMM E-Value=1.3e-14) 30 2.3 SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 29 3.1 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_52622| Best HMM Match : Ank (HMM E-Value=1.2e-05) 29 5.4 SB_54206| Best HMM Match : SET (HMM E-Value=0.029) 28 7.2 SB_28876| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 7.2 SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) 28 9.5 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_29928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 28 9.5 SB_42674| Best HMM Match : DUF26 (HMM E-Value=1) 28 9.5 >SB_40413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 114 bits (274), Expect = 8e-26 Identities = 77/183 (42%), Positives = 105/183 (57%), Gaps = 8/183 (4%) Frame = +2 Query: 74 VRAKIASKRNPEKEKEAQEWIEGVLGAKF--PPG--ELFEDVLKDGTVLCQLINKLKPGS 241 V+A I SK +P KE+EA++WI+ VLG G + LKDG VLC+L N+L G Sbjct: 420 VKAGIDSKYDPTKEEEARKWIDTVLGESIFGENGGVDTVHQTLKDGQVLCRLANRL--GG 477 Query: 242 VPKINTTGGQFKMMENITNFQSAIKA-YGVPDIDVFQTVDLWEKKDIAQVVSTLFALGRE 418 KIN FK MENI NF S I+ GV D+FQTVDL+EK ++ V+ + A+GR Sbjct: 478 DLKINQQKMPFKQMENIGNFLSFIENNLGVAKNDLFQTVDLYEKSNMWNVICCIHAVGRR 537 Query: 419 TYRHAEWSGPCLGPKPADECKRDFSDEVLKAGQTVI-GLQAG--SNKGATQSGQNLGAGR 589 Y + P LGPK + + R F++ L G+T+I Q G + AT SGQ+ G R Sbjct: 538 AYSLGK-DVPQLGPKESTKNPRQFTERQLNEGKTIINSFQMGPAAKNVATASGQSFGRQR 596 Query: 590 KIL 598 +I+ Sbjct: 597 QII 599 >SB_40412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 101 bits (242), Expect = 6e-22 Identities = 60/146 (41%), Positives = 87/146 (59%), Gaps = 4/146 (2%) Frame = +2 Query: 92 SKRNPEKEKEAQEWIEGVLGAKFPPGELFED----VLKDGTVLCQLINKLKPGSVPKINT 259 +K + + +A WIEG+LG + G+ D VLKDG VLC++ NKL G KIN+ Sbjct: 62 AKYDSDLAAQATAWIEGILGERVFGGKTGADDVHEVLKDGQVLCRVANKL--GGNIKINS 119 Query: 260 TGGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFALGRETYRHAEW 439 + FKMMEN F GVP D+FQTVDL+EK+++ V++ + ALGR+ + + Sbjct: 120 SKMAFKMMENTGKFLEFCDTIGVPKTDMFQTVDLYEKQNMPGVINGIHALGRKAHSTGK- 178 Query: 440 SGPCLGPKPADECKRDFSDEVLKAGQ 517 + LGPK A R+F++E +AGQ Sbjct: 179 TCLALGPKEASANPREFTEEQRRAGQ 204 >SB_18673| Best HMM Match : CH (HMM E-Value=2.5e-05) Length = 195 Score = 83.8 bits (198), Expect = 1e-16 Identities = 61/152 (40%), Positives = 83/152 (54%), Gaps = 4/152 (2%) Frame = +2 Query: 83 KIASKRNPEKEKEAQEWIEGVLGAK-FPPGELFEDV---LKDGTVLCQLINKLKPGSVPK 250 KI K +P++E+EA+ WIE VLG K F E +DV LKDG +L +L KL G+ K Sbjct: 17 KILEKYDPQQEEEARIWIEAVLGEKVFGGAEGPDDVQKVLKDGKILARLAIKL--GAKIK 74 Query: 251 INTTGGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFALGRETYRH 430 +N FK MENI NF S GV D FQT DL+ D A + S + Sbjct: 75 VNEQNMPFKQMENIGNFLSHCGHLGVASGDQFQTADLY---DNANMTSCQLIKDLDI--- 128 Query: 431 AEWSGPCLGPKPADECKRDFSDEVLKAGQTVI 526 P LGPK A+ R+F++E L+AG++++ Sbjct: 129 -----PTLGPKEAEANVREFTEEQLRAGESIL 155 >SB_7905| Best HMM Match : CH (HMM E-Value=1.3e-10) Length = 172 Score = 75.4 bits (177), Expect = 5e-14 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 5/116 (4%) Frame = +2 Query: 56 MSLERQVRAKIASKRNP---EKEKEAQEWIEGVLGAKF--PPGELFEDVLKDGTVLCQLI 220 +S E +K + P ++ K + WIEG F + F++ LK G VLC+L Sbjct: 45 VSKENLKTSKFIMSKKPWPMDRAKVVRMWIEGKTSCNFGGDTADDFQNTLKSGVVLCKLA 104 Query: 221 NKLKPGSVPKINTTGGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQV 388 N ++PG++ KIN F MMENI NF + ++ GV F T+DL+E K++ QV Sbjct: 105 NAIQPGAIKKINNAKMNFMMMENIENFCNFVQTKGVASQYQFVTIDLFEGKNMHQV 160 >SB_39070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 70.1 bits (164), Expect = 2e-12 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 10/118 (8%) Frame = +2 Query: 65 ERQVRAKIASKRNPEKEKEAQEWIEGVLGAKFP---------PGELFEDVLKDGTVLCQL 217 E+ ++ +K E E A+ W+E + G PGE F + L+ G +LC++ Sbjct: 259 EKNNVGQVDAKYPKELEGNARRWVETMYGDTVAWGEERPNQRPGETFAEPLRSGVILCKI 318 Query: 218 INKLKPGSVPKINTTGGQFKMMENITNF-QSAIKAYGVPDIDVFQTVDLWEKKDIAQV 388 NK+K ++PKI + F M ENI+ F + G+ +++FQTVDL+E++++ V Sbjct: 319 ANKIKSNAIPKIGESNKSFVMQENISKFLDFCERVLGLDRLNLFQTVDLFERQNVGMV 376 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 9/62 (14%) Frame = +2 Query: 53 NMSLERQVRAKIASKRNPEKEKEAQEWIEGVLGAKFP---------PGELFEDVLKDGTV 205 + L +V KI SK + E E + ++W+E +LG PGE F D + DG V Sbjct: 14 SFGLTAEVNRKIQSKYDTELEMQCRDWLEKMLGENIEWGVETEYSRPGESFADGIFDGIV 73 Query: 206 LC 211 LC Sbjct: 74 LC 75 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +2 Query: 215 LINKLKPGSVPKIN-TTGGQF---KMMENITNFQSAIKA--YGVPDIDVFQTVDLWEKKD 376 ++N++ PG++ KI+ GG+F +++ENI F A + + +D+F DL+EK + Sbjct: 203 VMNEVFPGAISKIHGINGGRFHGFQILENIEKFLKACQGEPFNCNVVDLFSPGDLYEKNN 262 Query: 377 IAQV 388 + QV Sbjct: 263 VGQV 266 >SB_20280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 56.8 bits (131), Expect = 2e-08 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 11/125 (8%) Frame = +2 Query: 68 RQVRAKIASKRNPEKEKEAQEWIE--GVLGAKF----PPGELFE--DVLKDGTVLCQLIN 223 R A +S R+ E+ K A++W+ GVL A P LF+ L+DG +LCQ+ N Sbjct: 7 RTASALSSSGRDVEEWKMARDWMISIGVLPAHGRVTDPNFTLFDFAQSLRDGVLLCQVAN 66 Query: 224 KLKPGSVPKINTTG--GQFKMMENITNFQSA-IKAYGVPDIDVFQTVDLWEKKDIAQVVS 394 L PG+V + QF ++NI NF +A + + + D D+F +L++ D +VV+ Sbjct: 67 VLHPGAVVDVGMKPQMSQFMCLKNIRNFLTACTRLFNLADGDLFDANELYDVSDFGKVVN 126 Query: 395 TLFAL 409 TL L Sbjct: 127 TLSKL 131 >SB_23839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +2 Query: 221 NKLKPGSVPKINTTGGQ--FKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDI 379 N ++PG + K + G+ FKMMENI F + IK+YGV + +F TVDL+EK+++ Sbjct: 189 NAIQPGVIKKPHLNPGKMGFKMMENIGWFVNFIKSYGVQEEYIFVTVDLYEKRNV 243 >SB_18675| Best HMM Match : NUMOD3 (HMM E-Value=8) Length = 89 Score = 48.8 bits (111), Expect = 5e-06 Identities = 30/83 (36%), Positives = 46/83 (55%) Frame = +2 Query: 275 KMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFALGRETYRHAEWSGPCL 454 + MENI NF ++ GV +D+FQTVDL+EK+++A R + P L Sbjct: 16 RKMENIGNFLLFCESLGVSKVDLFQTVDLYEKQNMAAA------------RAKGLNCPQL 63 Query: 455 GPKPADECKRDFSDEVLKAGQTV 523 GPK A+ R F ++ L+AG+ + Sbjct: 64 GPKEAEANPRSFDEDKLRAGKGI 86 >SB_36121| Best HMM Match : CH (HMM E-Value=0.0017) Length = 209 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/83 (33%), Positives = 42/83 (50%) Frame = +2 Query: 119 EAQEWIEGVLGAKFPPGELFEDVLKDGTVLCQLINKLKPGSVPKINTTGGQFKMMENITN 298 EA+ WIE F + F + L DG +LC+LI + SV +IN G +N++ Sbjct: 32 EARRWIERATFTPFKNDD-FRESLADGVLLCELIVNVANISVGRINKQGTAHAGRDNLSV 90 Query: 299 FQSAIKAYGVPDIDVFQTVDLWE 367 F A +A G+ +F+ DL E Sbjct: 91 FFRACEALGLDKYQLFEHEDLDE 113 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +2 Query: 239 SVPKINTTGGQFKMMENITNFQSAIKA--YGVPDIDVFQTVDLWEKKDIAQVVSTLFALG 412 + P N M ENI NF +A + + D+FQTV L+E++++ QV+S + A Sbjct: 884 NTPSTNRKSTSLGMQENIANFLNACQEEPFNCNPQDLFQTVYLFERQNLGQVISGIQAFA 943 Query: 413 RETYRH 430 R+ +H Sbjct: 944 RKVRKH 949 >SB_28994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Frame = +2 Query: 188 LKDGTVLCQLINKLKPGSVPKINTTGG------QFKMMENITNFQSAIKAYGVPDIDVFQ 349 L DG VLC L+N G++P I+ K M+N+ F A K GV + Sbjct: 336 LADGVVLCHLVNSAYKGTIPSIHIPSAGVPKLTMTKCMKNVDYFLEACKKLGVDRELLCS 395 Query: 350 TVDLWEKKDIAQVVSTLFAL 409 + D+ ++K +V +T+ AL Sbjct: 396 SADILQEKSPQRVCATVQAL 415 >SB_53975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +2 Query: 86 IASKRNPEKEKEAQEWIEGVLGAKFPPGE-LFEDVLKDGTVL 208 +++K +P + EA +WIE VLG K G+ + EDVLKDG +L Sbjct: 1 MSAKYDPVMDAEAVDWIEKVLGEKVCQGKSINEDVLKDGQIL 42 >SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) Length = 959 Score = 38.7 bits (86), Expect = 0.005 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 22/130 (16%) Frame = +2 Query: 104 PEKEKEAQEWIEGVLGAKFPPGELFEDVLKDGTVLCQLINKLKP---------------G 238 P KE A WI +LG + + F +L G VLC+L N ++ G Sbjct: 27 PLKEDLAS-WISRLLGEEELNTDTFTSMLDTGVVLCRLANFIQTVGEEFFVRNPKFPRRG 85 Query: 239 SVPKINTT-------GGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVST 397 P T G F +N++NF + VPD+ +F+T DL K+ V+ T Sbjct: 86 LFPACGVTYKQRGATHGSFVARDNVSNFIRWCRELRVPDVIMFETEDLVLNKNEKTVLLT 145 Query: 398 LFALGRETYR 427 L + R+ ++ Sbjct: 146 LLEVARKAFK 155 >SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) Length = 819 Score = 35.5 bits (78), Expect = 0.047 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 281 MENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQV 388 M I F +GV D+FQTVDL+EK++I QV Sbjct: 700 MVTIAKFLDFCGTFGVAKSDLFQTVDLYEKQNIQQV 735 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 71 QVRAKIASKRNPEKEKEAQEWIEGVLG 151 ++ K+++K +P + EA +WIE VLG Sbjct: 671 ELSRKMSAKYDPVMDAEAVDWIEKVLG 697 >SB_47687| Best HMM Match : SCP (HMM E-Value=1.8e-16) Length = 600 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/61 (34%), Positives = 31/61 (50%) Frame = +2 Query: 14 SSQHSEKALTQSHNMSLERQVRAKIASKRNPEKEKEAQEWIEGVLGAKFPPGELFEDVLK 193 SSQ +EK L HNMS + + K + + E+EK+ + EG K P E ++ K Sbjct: 19 SSQQTEKELANGHNMSKGDETKEKPSHRAEKEQEKDNKSSKEG--ETKEPKKEKADNEHK 76 Query: 194 D 196 D Sbjct: 77 D 77 >SB_7838| Best HMM Match : Filamin (HMM E-Value=1.1e-22) Length = 820 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 176 FEDVLKDGTVLCQLINKLKPGSVPKINTTGGQFKMMENITNFQSAIKAYGVP 331 F+ +DG +C+L+N L+PG +P Q+A A+G+P Sbjct: 449 FDTDWRDGMAICELVNALQPGLIPDSKYKEKTNSEATAKIGIQTAHDAFGIP 500 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 32.7 bits (71), Expect = 0.33 Identities = 22/79 (27%), Positives = 41/79 (51%) Frame = +2 Query: 8 GASSQHSEKALTQSHNMSLERQVRAKIASKRNPEKEKEAQEWIEGVLGAKFPPGELFEDV 187 G +S+ S + SH S E QV + ++++ +++ + A +L+E V Sbjct: 28 GGTSESSAEGTKHSH--SKEEQVAFADWINSSLKEDESVHKYLP--IDASEDSSDLYEKV 83 Query: 188 LKDGTVLCQLINKLKPGSV 244 KDG +LC++IN PG++ Sbjct: 84 -KDGILLCKMINLSAPGTI 101 >SB_2620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 37 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +2 Query: 446 PCLGPKPADECKRDFSDEVLKAGQTVI 526 P LGPK A+ R+F++E L+AG++++ Sbjct: 10 PTLGPKEAEANVREFTEEQLRAGESIL 36 >SB_56324| Best HMM Match : ASC (HMM E-Value=1.3e-14) Length = 416 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = -3 Query: 264 PVVLILGTEPGFSLLMSWQRTVPSLRT--SSNSSPGGNLAPRTPSIHSWASFSFSGLRL 94 P V I P + SW T P L + N++PG P ++W F +G RL Sbjct: 145 PAVTICNNNP---IRKSWAATTPYLPVIMAYNANPGEEAIPINWDAYNWTGFGGAGFRL 200 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 181 GCPQGRHCSLPAHQQAEAWLCPQDQHHRWTVQNDGEHHKLPVCNQSIRCTRHRCVPNRRS 360 G QG C L + +++ + TVQ + EH K+ + ++I + + + Sbjct: 267 GKHQGHRCDLASRLATNV----REELSKITVQIEEEHEKIVMARRAIEARKEAITQKKEA 322 Query: 361 MGEK-RHRPSSQHTV 402 +G+K H+ S TV Sbjct: 323 LGQKIAHQASGIRTV 337 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = -3 Query: 645 LKINITLCWCCVHLPIKILRPAPRFCPD*VAPLLDPACRPITVC 514 +++ + +C+ CVHL +++ P C + P C + C Sbjct: 1039 VRVCLPVCFSCVHLSVRVCLPVCFSCVHLSVRVCSPVCSRVFTC 1082 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = -3 Query: 678 VHYHTNLYKIILKINITLCWCCVHLPIKILRPAPRFCPD*VAPLLDPACRPITVC 514 VH + + T + CVHL +++ P C +L P C + C Sbjct: 1102 VHLSVRVLSPVCSRVFTCLYACVHLSVRVCLPVCFSCVHLSVRVLSPVCPRVFTC 1156 >SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 452 LGPKPADECKRDFSDEVLKAGQTVIG 529 LGP P+D+ RDF L++GQ V G Sbjct: 233 LGPDPSDKKVRDFIWNTLQSGQVVPG 258 >SB_52622| Best HMM Match : Ank (HMM E-Value=1.2e-05) Length = 402 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 26 SEKALTQSHNMSLERQVRAKIASKRNPEKEKEAQEWI 136 + +A T+ N + Q R KIA +R + E+E QE+I Sbjct: 250 ANRAKTEDKNRQSDFQEREKIARERTRQLEQEHQEYI 286 >SB_54206| Best HMM Match : SET (HMM E-Value=0.029) Length = 160 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +1 Query: 268 TVQNDGEHHKLPVCNQSIRCTRHRCVPNRRSMGEKRH 378 TVQ D E H LP N S T H C PN + + R+ Sbjct: 44 TVQVDKEKHILPASNLSY--TNHSCDPNAEFVFKPRN 78 >SB_28876| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 356 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 444 PLHSACL*VSRPRANSVLTTWAMSFFSHRSTVWNTSMSGTPYALIADW 301 PLH+ L SR R + TW ++FF+ ++ ++ + DW Sbjct: 134 PLHAGTLITSRRRYFLIAATWVIAFFNASPLLYTMTLDNNNLCQL-DW 180 >SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 2532 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 131 WIEGVLGAKF--PPGELFEDVLKDGTVLCQLINKLKPGSVP 247 ++ G +G K+ PP FE +L+ T +I L PGS P Sbjct: 1904 FVTGRMGEKYVTPPVLSFESILEQSTPFSPIIFILSPGSDP 1944 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/51 (25%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 184 CPQGRHCSLPAHQQA--EAWLCPQDQHHRWTVQNDGEHHKLPVCNQSIRCT 330 CP G +C H + W CP+ H W G + + +CT Sbjct: 917 CPAGHYCIDGKHPEPCPAGWYCPEGTGHDWQPCPRGTYSPAQYLSHLGQCT 967 >SB_29928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 137 EGVLGAKFPPGELFEDVLKDGTVLCQLINKLKPGSVPKINTTG 265 +G LGA F P +LF + + + ++N G V + TG Sbjct: 73 QGSLGANFDPSKLFYGYMANLNIWANVLNDFNRGKVYEQGCTG 115 >SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 558 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 405 PSVVRLTDTRNGAAPASDPSPLTNANVTFLMKS*RPGK 518 PS +R+ D + P + P+T V + S +PGK Sbjct: 20 PSTIRILDVCSNTTPCRELRPVTEGQVLKELHSLKPGK 57 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 405 PSVVRLTDTRNGAAPASDPSPLTNANVTFLMKS*RPGK 518 PS +R+ D + P + P+T V + S +PGK Sbjct: 467 PSTIRILDVCSNTTPCRELRPVTEGQVLKELHSLKPGK 504 >SB_42674| Best HMM Match : DUF26 (HMM E-Value=1) Length = 493 Score = 27.9 bits (59), Expect = 9.5 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +2 Query: 146 LGAKFPPGELFEDV--LKDGTVLCQLINKLKPGSVPKINTTGGQFKMMENITNFQSAIKA 319 L A PP DV L GT L LKP PK+ G + + +I F S++ A Sbjct: 89 LMATLPPTSTAHDVERLSTGTKFA-LRQWLKPIVAPKVCNNTGLHRPVAHIPPFTSSVAA 147 Query: 320 YGVPDIDVFQTVDLWEKKDIAQVVST 397 G I + W D ++++ + Sbjct: 148 QGKAPIKSVSALS-WPGTDQSEIMDS 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,522,269 Number of Sequences: 59808 Number of extensions: 600285 Number of successful extensions: 1722 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1710 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -