BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0135 (663 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 4.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 6.5 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 598 DALNRYRTAGRVSSP*HHCA*CEFFKLFL*RKGWLIF 488 +A + YR G V SP H+ A E + + K +L+F Sbjct: 110 NASSEYRINGSVVSPQHYLAELEKIGINVKAKNFLVF 146 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 453 SGKRTQTIPFHTNMSQPLRYRKSLK 527 S R + +PF+++ ++ LRY + +K Sbjct: 319 SNGRFEQVPFNSDQNEDLRYAQIIK 343 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 453 SGKRTQTIPFHTNMSQPLRYRKSLK 527 S R + +PF+++ ++ LRY + +K Sbjct: 319 SNGRFEQVPFNSDQNEDLRYAQIIK 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,707 Number of Sequences: 2352 Number of extensions: 9629 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -