BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0135 (663 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024751-8|AAK21510.3| 369|Caenorhabditis elegans Hypothetical ... 30 1.7 U53340-7|AAA96211.2| 1383|Caenorhabditis elegans Npc1 (human nie... 29 2.2 >AC024751-8|AAK21510.3| 369|Caenorhabditis elegans Hypothetical protein Y18H1A.7 protein. Length = 369 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 129 STGRVRKLVKLSLVRN*KLTRDRKSTEN 212 ST ++RKLVK+S + + KL + STEN Sbjct: 159 STPKIRKLVKISKICSEKLPKTANSTEN 186 >U53340-7|AAA96211.2| 1383|Caenorhabditis elegans Npc1 (human niemann pick c disease)related protein 1 protein. Length = 1383 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 411 KS*ANFVCNWNSAPSGKRTQTIPFHTNMSQPLRYRKSLKNSH 536 K N V W+S S R + + F+ N +P RY++ + SH Sbjct: 375 KESTNVVDMWSSPRSRARQEEMVFNANFGRPQRYQQIMLLSH 416 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,431,286 Number of Sequences: 27780 Number of extensions: 222079 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -