BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0135 (663 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 29 2.1 At3g11210.1 68416.m01362 GDSL-motif lipase/hydrolase family prot... 29 3.6 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 532 RTKHNDVTESLHVPQSGSDSTHHRKYHFQITMNNL 636 R+ HN T + +P +++THH+ Y ++M+ L Sbjct: 162 RSHHNSSTLHMLLPSPSTNTTHHQNYTNHMSMHQL 196 >At3g11210.1 68416.m01362 GDSL-motif lipase/hydrolase family protein contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 256 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 415 LLRYRENVKKLALSTQNASDFVKI 344 L Y +N+KK+AL Q+ SDF +I Sbjct: 95 LTEYVDNMKKIALHLQSLSDFTRI 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,281,173 Number of Sequences: 28952 Number of extensions: 192942 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -