BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0133 (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyce... 26 5.9 SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |S... 25 7.9 SPCC645.04 |nse3||Smc5-6 complex non-SMC subunit Nse3 |Schizosac... 25 7.9 >SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +1 Query: 364 VYDLRSLSLLKTSEASKLSSIGSYLS*ASTAKNRPRKTNSSFILKFSTRFPST 522 VY+L+++ L+ T SK + I + A N P ++ T P T Sbjct: 109 VYNLKNMELINTLNTSKGNVIAFAVHENYVAYNSPTNPGDIYLASLDTAIPVT 161 >SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |Schizosaccharomyces pombe|chr 3|||Manual Length = 660 Score = 25.4 bits (53), Expect = 7.9 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 5/81 (6%) Frame = -2 Query: 386 ERLLKSY---TKCLLNQGPCTAELKKIKDKIPEAL--ETHCAKCTDKQKQMAKQLAQGIK 222 ERL+KS KC LN + ++ K P ++ + +K++ L + ++ Sbjct: 433 ERLVKSQGDLVKCFLN---IQYRMHELISKFPSDTFYDSKLVPAEEVKKRLLMDL-ENVE 488 Query: 221 KTHPELWDEFITFYDPQGKYQ 159 +T EL D I FYD G YQ Sbjct: 489 ET--ELTDSPIYFYDTLGNYQ 507 >SPCC645.04 |nse3||Smc5-6 complex non-SMC subunit Nse3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 328 Score = 25.4 bits (53), Expect = 7.9 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -3 Query: 310 IKFQKLWRPIVRNVLINRSRWRNNLRKELRRHTRSYGTSSLLFTTLKE 167 I FQ L R +VR + +++ RK++ + GTS LF ++ E Sbjct: 88 INFQLLVRNVVRYAICSQTSHNTITRKDIVQKAFPEGTSRNLFQSVFE 135 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,648,337 Number of Sequences: 5004 Number of extensions: 53095 Number of successful extensions: 157 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -