BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0133 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0594 + 25349612-25352530 28 6.1 11_06_0567 - 25038537-25038957,25039059-25039252 28 8.1 01_06_0495 - 29779499-29781325 28 8.1 >11_06_0594 + 25349612-25352530 Length = 972 Score = 28.3 bits (60), Expect = 6.1 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +1 Query: 247 AICFCLSVHFAQWVSKASGILSLIF 321 ++CFC +H + W+S A +L+ + Sbjct: 426 SLCFCSPLHLSSWLSNAEKMLTFCY 450 >11_06_0567 - 25038537-25038957,25039059-25039252 Length = 204 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 232 CASCFAICFCLSVHFAQWVSKASGILSLI 318 C + A FC VH A +VS A+G+ L+ Sbjct: 135 CTTAAAGNFCNQVHIAMYVSLAAGVALLV 163 >01_06_0495 - 29779499-29781325 Length = 608 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -2 Query: 317 IKDKIP-EALETHCAKCTDKQKQMAKQLAQGIKKTHPELWDEFITFYDPQGKYQTSFKDF 141 +KD IP L T +K D K A++L G+ + W+ I Y G+YQ + + F Sbjct: 148 VKDPIPMNCLITGYSKSGDVVK--ARRLFDGMVRRTSASWNSMIACYAHGGEYQEALRLF 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,283,453 Number of Sequences: 37544 Number of extensions: 275799 Number of successful extensions: 594 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -