BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0128 (393 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 25 0.20 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 23 1.1 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 23 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 3.3 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 3.3 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 25.4 bits (53), Expect = 0.20 Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 330 WHIESWKHTYEVKTGAHFQFENLFNGNKVLATPVEE--FVNSNWKDVMQEVAPPIVRSI 160 W+ ++ ++Y+ + F+N +G A P +E F W +V+ P + ++ Sbjct: 188 WYSQTIDNSYQFCDNLQYSFDNQCSGTIDWALPKQEDCFYQEGWNGQSFDVSQPALTTL 246 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 23.0 bits (47), Expect = 1.1 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 24 LPKKSNFIYHIY 59 LPK+SN I HIY Sbjct: 81 LPKESNAIIHIY 92 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 125 YRAFTAATTSDTMDRTMG 178 +RAFTA+ + DT+ + +G Sbjct: 12 WRAFTASWSPDTLAKNLG 29 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 3.3 Identities = 7/24 (29%), Positives = 11/24 (45%) Frame = -3 Query: 238 NSRRRICELKLEGRDAGSSPAHRP 167 N R+IC+ + P H+P Sbjct: 1138 NKERKICDWPKSAKCEEKKPGHKP 1161 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +2 Query: 308 CFH-DSICQCGLAVSSCHC 361 C H D+ICQ L +C+C Sbjct: 425 CKHLDAICQDKLGDYACYC 443 Score = 20.2 bits (40), Expect = 7.6 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -2 Query: 263 CLMETRCWQL 234 C TRCW++ Sbjct: 528 CTASTRCWEV 537 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,802 Number of Sequences: 336 Number of extensions: 2048 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8330471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -