BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0128 (393 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050397-1|AAH50397.1| 489|Homo sapiens MARCH9 protein protein. 29 5.5 BC036455-1|AAH36455.2| 346|Homo sapiens membrane-associated rin... 29 5.5 AK095107-1|BAC04487.1| 224|Homo sapiens protein ( Homo sapiens ... 28 9.5 >BC050397-1|AAH50397.1| 489|Homo sapiens MARCH9 protein protein. Length = 489 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 217 ELKLEGRDAGSSPAHRPVHRV-RGGGCCKCPVQGCAGR 107 ELKL G P P R RGGGC P GC+ R Sbjct: 155 ELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTR 192 >BC036455-1|AAH36455.2| 346|Homo sapiens membrane-associated ring finger (C3HC4) 9 protein. Length = 346 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 217 ELKLEGRDAGSSPAHRPVHRV-RGGGCCKCPVQGCAGR 107 ELKL G P P R RGGGC P GC+ R Sbjct: 12 ELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTR 49 >AK095107-1|BAC04487.1| 224|Homo sapiens protein ( Homo sapiens cDNA FLJ37788 fis, clone BRHIP2028593, weakly similar to Homo sapiens IL-1 receptor accessory protein mRNA. ). Length = 224 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 217 ELKLEGRDAGSSPAHRPV--HRVRGGGCCKCPVQGCAGRRTL 98 EL+ R AGS PA + HR + C+C V C G L Sbjct: 119 ELQSSERAAGSPPAPGTMSKHRGKSSATCRCCVTYCEGENHL 160 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,409,950 Number of Sequences: 237096 Number of extensions: 1174237 Number of successful extensions: 3246 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3246 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2756025120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -