BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0120 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 2.8 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 8.5 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.6 bits (51), Expect = 2.8 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 535 MGT-RNCLESH*YDLYKIQTNKPNYFKLRNLYST 437 MGT RNC Y +K+ +P Y + + Y+T Sbjct: 1277 MGTERNCFTVTAYRRFKVALKRPAYVVVYDYYNT 1310 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 593 VMLCHFVNSRNFQCRPRTNNGD 528 VML VN CRP T N D Sbjct: 3 VMLKQEVNLSRRACRPTTTNND 24 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,025 Number of Sequences: 2352 Number of extensions: 15134 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -