BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0117 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 8.6 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 8.6 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 8.6 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 8.6 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 8.6 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 8.6 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 8.6 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 271 FRIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNKTKL 140 F +F L++ + +HR I +I T LC K K +L Sbjct: 1330 FVFFFALILVIQFVAMLFHRFGTIAHILASTELNLCCTKKKEEL 1373 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 271 FRIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNKTKL 140 F +F L++ + +HR I +I T LC K K +L Sbjct: 1330 FVFFFALILVIQFVAMLFHRFGTIAHILASTELNLCCTKKKEEL 1373 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 271 FRIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNKTKL 140 F +F L++ + +HR I +I T LC K K +L Sbjct: 1330 FVFFFALILVIQFVAMLFHRFGTIAHILASTELNLCCTKKKEEL 1373 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 271 FRIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNKTKL 140 F +F L++ + +HR I +I T LC K K +L Sbjct: 1330 FVFFFALILVIQFVAMLFHRFGTIAHILASTELNLCCTKKKEEL 1373 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 545 LGRISKPRTSKCHHTAYFCPESVLSS 468 + ++S PR+S + P+SV S+ Sbjct: 148 MNKVSTPRSSPAETASSLSPQSVAST 173 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 520 VRGLEMRPSTGNTPYHQYLNTVKFNH 597 +R L RP TP +QY N ++++ Sbjct: 126 LRALLTRPQAKKTPPNQYENFQQYDN 151 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 520 VRGLEMRPSTGNTPYHQYLNTVKFNH 597 +R L RP TP +QY N ++++ Sbjct: 126 LRALLTRPQAKKTPPNQYENFQQYDN 151 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 332 ILYKIFINTFFVC*LIIKKV 273 IL+ ++T F+C I+KKV Sbjct: 160 ILWVGILSTIFLCDTILKKV 179 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 506 HTAYFCPESVLSSGFKGGIS 447 H + P LSSG GG+S Sbjct: 73 HGPPYAPHPSLSSGLGGGLS 92 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 545 LGRISKPRTSKCHHTAYFCPESVLSS 468 + ++S PR+S + P+SV S+ Sbjct: 139 MNKVSTPRSSPAETASSLSPQSVAST 164 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 520 VRGLEMRPSTGNTPYHQYLNTVKFNH 597 +R L RP TP +QY N ++++ Sbjct: 126 LRALLTRPQAKKTPPNQYENFQQYDN 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,898 Number of Sequences: 336 Number of extensions: 3931 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -