BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0117 (798 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 27 4.1 SPCP25A2.03 |||THO complex subunit |Schizosaccharomyces pombe|ch... 27 4.1 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -2 Query: 731 NSSFILKFSTRFPSTSV*QSYLPLFLPPPGRFSP 630 NSSF +KF FP S+ Y F+ P SP Sbjct: 1287 NSSFDMKFGLHFPKISL-NLYDGTFITPENSLSP 1319 >SPCP25A2.03 |||THO complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 752 Score = 26.6 bits (56), Expect = 4.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 241 SSNQHINYHRKIAILYISTFTTYCLCIVKNKTKLLNSVSASK 116 S ++YH+K+ L+ + + C+C N KLL S + K Sbjct: 209 SDRTDLSYHKKLNTLFTAYWDLQCMC--SNPPKLLASDTLPK 248 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,945,575 Number of Sequences: 5004 Number of extensions: 60954 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -