BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0117 (798 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) 30 2.5 >SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) Length = 987 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/79 (20%), Positives = 40/79 (50%) Frame = -3 Query: 325 IKYLLIPFLFVN*LLKRCFRIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNKT 146 + ++ F++VN +L + F + I + + +K+ ++ + ++T V+N+ Sbjct: 591 VDFIAYTFVYVNSVLLLTLAVLFLVQIQVWSSLRRHRKKLKLMTLPSYTNGVNICVRNED 650 Query: 145 KLLNSVSASKINKTLVYMI 89 KLL +K+ KT + ++ Sbjct: 651 KLLQK-RDTKVTKTFLTLL 668 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,134,835 Number of Sequences: 59808 Number of extensions: 422107 Number of successful extensions: 744 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -