BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0116 (784 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containi... 29 3.5 At2g39360.1 68415.m04831 protein kinase family protein contains ... 28 8.0 >At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 904 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 464 GKRRCLDGTHYFIKRMCSFKHFHRTGEIFNTNI 562 G+R D IK +C F F ++ ++FNT I Sbjct: 185 GRREEWDRAEDLIKELCGFHEFQKSYQVFNTVI 217 >At2g39360.1 68415.m04831 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 815 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 359 FPLSLLKWFL*RVYIMPAVSA 297 FP+ WFL R+Y +P VSA Sbjct: 90 FPIEEHGWFLIRIYFLPLVSA 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,438,469 Number of Sequences: 28952 Number of extensions: 254428 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -