BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0114 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 2.7 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 4.8 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +1 Query: 502 WLSFLKQTAQYSLSIIMSFSSYLYRFFSIRIIV 600 W S +K+ + S++ S+ ++L FS+ I++ Sbjct: 134 WESRIKEIESHFGSVVASYFTFLRWLFSVNIVI 166 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 679 KVIYTNVQSQYLDKRFSYFSYV 744 +V+YT+ Q L+K F Y Y+ Sbjct: 219 RVVYTDQQRLELEKEFHYTRYI 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 806,281 Number of Sequences: 2352 Number of extensions: 15885 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -